Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   VDS58_RS13790 Genome accession   NZ_CP141997
Coordinates   2531414..2531797 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   A0AAX3RJE0
Organism   Bacillus subtilis strain PM0031     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2526414..2536797
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VDS58_RS13750 (VDS58_13750) sinI 2527348..2527521 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  VDS58_RS13755 (VDS58_13755) sinR 2527555..2527890 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  VDS58_RS13760 (VDS58_13760) tasA 2527982..2528767 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  VDS58_RS13765 (VDS58_13765) sipW 2528832..2529404 (-) 573 WP_003246088.1 signal peptidase I SipW -
  VDS58_RS13770 (VDS58_13770) tapA 2529388..2530149 (-) 762 WP_064671037.1 amyloid fiber anchoring/assembly protein TapA -
  VDS58_RS13775 (VDS58_13775) yqzG 2530420..2530746 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  VDS58_RS13780 (VDS58_13780) spoIITA 2530788..2530967 (-) 180 WP_014480252.1 YqzE family protein -
  VDS58_RS13785 (VDS58_13785) comGG 2531039..2531413 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  VDS58_RS13790 (VDS58_13790) comGF 2531414..2531797 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  VDS58_RS13795 (VDS58_13795) comGE 2531823..2532170 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene
  VDS58_RS13800 (VDS58_13800) comGD 2532154..2532585 (-) 432 WP_032726159.1 competence type IV pilus minor pilin ComGD Machinery gene
  VDS58_RS13805 (VDS58_13805) comGC 2532575..2532871 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  VDS58_RS13810 (VDS58_13810) comGB 2532885..2533922 (-) 1038 WP_086344083.1 comG operon protein ComGB Machinery gene
  VDS58_RS13815 (VDS58_13815) comGA 2533909..2534979 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  VDS58_RS13820 (VDS58_13820) corA 2535383..2536336 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=920728 VDS58_RS13790 WP_032726158.1 2531414..2531797(-) (comGF) [Bacillus subtilis strain PM0031]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=920728 VDS58_RS13790 WP_032726158.1 2531414..2531797(-) (comGF) [Bacillus subtilis strain PM0031]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGATATCCGTTTTGACATTTATCATTCAATGATCAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992