Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   VKS18_RS11725 Genome accession   NZ_CP141895
Coordinates   2441168..2441434 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain B004     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2436168..2446434
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VKS18_RS11675 (VKS18_01600) sinR 2436331..2436666 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  VKS18_RS11680 (VKS18_01605) - 2436714..2437499 (-) 786 WP_032874027.1 TasA family protein -
  VKS18_RS11685 (VKS18_01610) - 2437564..2438148 (-) 585 WP_032874025.1 signal peptidase I -
  VKS18_RS11690 (VKS18_01615) tapA 2438120..2438791 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  VKS18_RS11695 (VKS18_01620) - 2439050..2439379 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  VKS18_RS11700 (VKS18_01625) - 2439420..2439599 (-) 180 WP_022552966.1 YqzE family protein -
  VKS18_RS11705 (VKS18_01630) comGG 2439656..2440033 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  VKS18_RS11710 (VKS18_01635) comGF 2440034..2440498 (-) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  VKS18_RS11715 (VKS18_01640) comGE 2440443..2440757 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  VKS18_RS11720 (VKS18_01645) comGD 2440741..2441178 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  VKS18_RS11725 (VKS18_01650) comGC 2441168..2441434 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  VKS18_RS11730 (VKS18_01655) comGB 2441481..2442518 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  VKS18_RS11735 (VKS18_01660) comGA 2442505..2443575 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  VKS18_RS11740 (VKS18_01665) - 2443772..2444722 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -
  VKS18_RS11745 (VKS18_01670) - 2444868..2446169 (+) 1302 WP_032874010.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=920372 VKS18_RS11725 WP_042635730.1 2441168..2441434(-) (comGC) [Bacillus velezensis strain B004]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=920372 VKS18_RS11725 WP_042635730.1 2441168..2441434(-) (comGC) [Bacillus velezensis strain B004]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGATCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602