Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGB   Type   Machinery gene
Locus tag   VDS61_RS05010 Genome accession   NZ_CP141812
Coordinates   964745..965746 (+) Length   333 a.a.
NCBI ID   WP_076786758.1    Uniprot ID   -
Organism   Latilactobacillus curvatus strain K285     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 964722..1003982 964745..965746 within 0


Gene organization within MGE regions


Location: 964722..1003982
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VDS61_RS05010 (VDS61_04995) comGB 964745..965746 (+) 1002 WP_076786758.1 type II secretion system F family protein Machinery gene
  VDS61_RS05015 (VDS61_05000) - 965799..967223 (-) 1425 WP_324722217.1 recombinase family protein -
  VDS61_RS05020 (VDS61_05005) - 967336..968217 (-) 882 WP_324722218.1 Ltp family lipoprotein -
  VDS61_RS05025 (VDS61_05010) - 968280..968996 (-) 717 WP_065825488.1 hypothetical protein -
  VDS61_RS05030 (VDS61_05015) - 969017..969409 (-) 393 WP_324722219.1 DUF4064 domain-containing protein -
  VDS61_RS05035 (VDS61_05020) - 969530..970246 (-) 717 WP_065825488.1 hypothetical protein -
  VDS61_RS05040 (VDS61_05025) - 970267..970659 (-) 393 WP_324722219.1 DUF4064 domain-containing protein -
  VDS61_RS05045 (VDS61_05030) - 970780..971496 (-) 717 WP_065825488.1 hypothetical protein -
  VDS61_RS05050 (VDS61_05035) - 971517..971909 (-) 393 WP_324722219.1 DUF4064 domain-containing protein -
  VDS61_RS05055 (VDS61_05040) - 971981..972382 (-) 402 WP_284182909.1 ImmA/IrrE family metallo-endopeptidase -
  VDS61_RS05060 (VDS61_05045) - 972384..972719 (-) 336 WP_259770237.1 helix-turn-helix domain-containing protein -
  VDS61_RS05065 (VDS61_05050) - 972868..973095 (+) 228 WP_284182910.1 helix-turn-helix domain-containing protein -
  VDS61_RS05070 (VDS61_05055) - 973114..973278 (+) 165 WP_155759442.1 hypothetical protein -
  VDS61_RS05075 (VDS61_05060) - 973338..973889 (+) 552 WP_324722220.1 helix-turn-helix transcriptional regulator -
  VDS61_RS05080 (VDS61_05065) - 973886..974038 (+) 153 WP_324722221.1 BOW99_gp33 family protein -
  VDS61_RS05085 (VDS61_05070) - 974345..974527 (+) 183 WP_324722222.1 hypothetical protein -
  VDS61_RS05090 (VDS61_05075) - 974527..974997 (+) 471 WP_324722223.1 host-nuclease inhibitor Gam family protein -
  VDS61_RS05095 (VDS61_05080) - 975009..975722 (+) 714 WP_284182969.1 AAA family ATPase -
  VDS61_RS05100 (VDS61_05085) - 975715..976293 (+) 579 WP_324722224.1 DUF669 domain-containing protein -
  VDS61_RS05105 (VDS61_05090) - 976306..977265 (+) 960 WP_324722225.1 DnaD domain protein -
  VDS61_RS05110 (VDS61_05095) - 977465..977995 (+) 531 WP_324722226.1 helix-turn-helix domain-containing protein -
  VDS61_RS05115 (VDS61_05100) - 977964..978173 (+) 210 WP_155760084.1 DUF6877 family protein -
  VDS61_RS05120 (VDS61_05105) - 978173..978337 (+) 165 WP_155275678.1 hypothetical protein -
  VDS61_RS05125 (VDS61_05110) - 978352..978546 (+) 195 WP_039098503.1 hypothetical protein -
  VDS61_RS05130 (VDS61_05115) - 978621..979613 (+) 993 WP_324722227.1 DNA cytosine methyltransferase -
  VDS61_RS05135 (VDS61_05120) - 979870..980271 (+) 402 WP_324722228.1 YopX family protein -
  VDS61_RS05140 (VDS61_05125) - 980271..980399 (+) 129 WP_324722229.1 hypothetical protein -
  VDS61_RS05145 (VDS61_05130) - 980399..980863 (+) 465 WP_324722230.1 DUF1064 domain-containing protein -
  VDS61_RS05150 (VDS61_05135) - 980875..981078 (+) 204 WP_065825503.1 hypothetical protein -
  VDS61_RS05155 (VDS61_05140) - 981098..981280 (+) 183 WP_065825504.1 hypothetical protein -
  VDS61_RS05160 (VDS61_05145) - 981280..981516 (+) 237 WP_039098607.1 helix-turn-helix domain-containing protein -
  VDS61_RS05165 (VDS61_05150) - 981630..982055 (+) 426 WP_065825505.1 ArpU family phage packaging/lysis transcriptional regulator -
  VDS61_RS05170 (VDS61_05155) - 982653..983021 (-) 369 WP_324722231.1 hypothetical protein -
  VDS61_RS05175 (VDS61_05160) - 983074..983241 (+) 168 WP_324722232.1 hypothetical protein -
  VDS61_RS05180 (VDS61_05165) - 983297..983455 (+) 159 WP_186738740.1 hypothetical protein -
  VDS61_RS05185 (VDS61_05170) - 983461..983634 (+) 174 WP_157779297.1 hypothetical protein -
  VDS61_RS05190 (VDS61_05175) - 983634..984488 (+) 855 WP_324722233.1 terminase small subunit -
  VDS61_RS05195 (VDS61_05180) - 984472..985755 (+) 1284 WP_324722258.1 PBSX family phage terminase large subunit -
  VDS61_RS05200 (VDS61_05185) - 985766..987214 (+) 1449 WP_324722234.1 phage portal protein -
  VDS61_RS05205 (VDS61_05190) - 987156..987470 (+) 315 WP_069468053.1 ribosomal-processing cysteine protease Prp -
  VDS61_RS05210 (VDS61_05195) - 987473..988666 (+) 1194 WP_324722235.1 minor capsid protein -
  VDS61_RS05215 (VDS61_05200) - 988835..989482 (+) 648 WP_324722236.1 DUF4355 domain-containing protein -
  VDS61_RS05220 (VDS61_05205) - 989495..989851 (+) 357 WP_273960332.1 hypothetical protein -
  VDS61_RS05225 (VDS61_05210) - 989874..990935 (+) 1062 WP_324722237.1 major capsid protein -
  VDS61_RS05230 (VDS61_05215) - 990950..991270 (+) 321 WP_324722238.1 phage head-tail connector protein -
  VDS61_RS05235 (VDS61_05220) - 991267..991653 (+) 387 WP_283534150.1 hypothetical protein -
  VDS61_RS05240 (VDS61_05225) - 991628..992149 (+) 522 WP_411377918.1 HK97 gp10 family phage protein -
  VDS61_RS05245 (VDS61_05230) - 992151..992516 (+) 366 WP_039098634.1 hypothetical protein -
  VDS61_RS05250 (VDS61_05235) - 992529..992993 (+) 465 WP_065825517.1 phage tail tube protein -
  VDS61_RS05255 (VDS61_05240) - 993050..993241 (+) 192 Protein_1002 Ig domain-containing protein -
  VDS61_RS05260 (VDS61_05245) - 993265..993669 (+) 405 WP_039098623.1 DUF6096 family protein -
  VDS61_RS05265 (VDS61_05250) - 993690..994067 (+) 378 WP_324722239.1 hypothetical protein -
  VDS61_RS05270 (VDS61_05255) - 994064..994264 (+) 201 WP_324722240.1 hypothetical protein -
  VDS61_RS05275 (VDS61_05260) - 994250..994624 (-) 375 WP_182159654.1 DUF2513 domain-containing protein -
  VDS61_RS05280 (VDS61_05265) - 994682..999487 (+) 4806 WP_324722241.1 phage tail protein -
  VDS61_RS05285 (VDS61_05270) - 999503..999862 (+) 360 WP_324722242.1 DUF6711 family protein -

Sequence


Protein


Download         Length: 333 a.a.        Molecular weight: 37893.09 Da        Isoelectric Point: 9.6278

>NTDB_id=919670 VDS61_RS05010 WP_076786758.1 964745..965746(+) (comGB) [Latilactobacillus curvatus strain K285]
MKTKTTVQFNTEFMLLLGRLLQNGFSLQQALEFMPIVFPTQKQWLHQVQTGLEAGKRLAPSLAAVSFPAHLVAQIELTEL
QGNLGECLLHLGQLQRIQQKRRRELVGVIAYPCFLLLFLGALIGMMQIYLFPEIAQFNPTTSATSPLQLFFRVMGTFVIM
AGALISVYFFRWHRRPLLQRLAAAFRWPFIGKTLQAYYQYCLLFDLATCLNNGLNLAEMHQLTHRLAKTSWLVQLMQQLE
TAVQKGGTLLANLADGVFYPPELQLVLAKGSPLQQMAKEVDLLAVIKYDELQRQLKQKVNWLQPLLFILIGIIIICTYLS
ILLPLYHTMEGIS

Nucleotide


Download         Length: 1002 bp        

>NTDB_id=919670 VDS61_RS05010 WP_076786758.1 964745..965746(+) (comGB) [Latilactobacillus curvatus strain K285]
ATGAAGACTAAAACCACTGTTCAATTCAATACTGAATTTATGTTGCTGTTAGGTCGCTTACTGCAAAATGGTTTTTCTTT
ACAACAAGCACTTGAGTTCATGCCGATTGTTTTTCCGACGCAAAAGCAGTGGCTGCATCAGGTGCAAACTGGGTTAGAAG
CAGGAAAACGACTAGCACCAAGCTTAGCGGCGGTTTCGTTTCCAGCACACCTTGTTGCACAGATTGAATTGACTGAGTTG
CAGGGAAACTTAGGCGAGTGTTTGTTACATCTTGGCCAATTACAGCGAATTCAACAGAAACGGCGTAGAGAGTTAGTTGG
CGTAATTGCCTATCCCTGTTTTCTACTCCTTTTTCTCGGGGCGTTGATTGGGATGATGCAGATTTATCTTTTTCCGGAAA
TCGCGCAGTTTAACCCAACAACTTCGGCGACATCACCATTACAACTATTTTTTAGAGTGATGGGGACATTCGTTATTATG
GCTGGTGCTCTGATTAGTGTGTATTTTTTCCGTTGGCATCGGCGACCGCTATTACAACGATTGGCGGCGGCATTTAGATG
GCCGTTCATCGGTAAAACGTTGCAGGCTTACTATCAGTATTGTTTATTATTTGATTTAGCGACTTGCCTGAATAACGGCT
TAAACTTGGCCGAAATGCATCAGCTTACACATCGTTTGGCGAAAACATCGTGGCTTGTACAATTAATGCAACAACTTGAA
ACGGCTGTCCAAAAAGGGGGCACGCTATTGGCGAACTTAGCGGATGGCGTTTTTTATCCACCTGAGCTGCAATTAGTGCT
CGCTAAGGGAAGTCCGTTACAACAGATGGCCAAGGAGGTTGATCTGCTTGCAGTCATTAAATACGATGAACTGCAACGGC
AATTGAAACAGAAGGTGAATTGGCTACAACCGCTCTTGTTTATCCTAATTGGGATCATCATTATTTGTACCTATCTCAGT
ATTTTATTACCGCTATATCATACAATGGAGGGAATTTCATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGB Latilactobacillus sakei subsp. sakei 23K

56.677

100

0.574