Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ABXV02_RS09720 Genome accession   NZ_CP159912
Coordinates   1823250..1823633 (+) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   P25958
Organism   Bacillus subtilis strain PY79     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1818250..1828633
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABXV02_RS09690 corA 1818703..1819656 (+) 954 WP_004399136.1 magnesium transporter CorA -
  ABXV02_RS09695 comGA 1820068..1821138 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ABXV02_RS09700 comGB 1821125..1822162 (+) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  ABXV02_RS09705 comGC 1822176..1822472 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ABXV02_RS09710 comGD 1822462..1822893 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  ABXV02_RS09715 comGE 1822877..1823224 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  ABXV02_RS09720 comGF 1823250..1823633 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  ABXV02_RS09725 comGG 1823634..1824008 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  ABXV02_RS09730 spoIITA 1824079..1824258 (+) 180 WP_003230176.1 YqzE family protein -
  ABXV02_RS09735 yqzG 1824300..1824626 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  ABXV02_RS09740 tapA 1824898..1825659 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  ABXV02_RS09745 sipW 1825643..1826215 (+) 573 WP_003246088.1 signal peptidase I SipW -
  ABXV02_RS09750 tasA 1826279..1827064 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  ABXV02_RS09755 sinR 1827157..1827492 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ABXV02_RS09760 sinI 1827526..1827699 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=915976 ABXV02_RS09720 WP_003230168.1 1823250..1823633(+) (comGF) [Bacillus subtilis strain PY79]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=915976 ABXV02_RS09720 WP_003230168.1 1823250..1823633(+) (comGF) [Bacillus subtilis strain PY79]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25958

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1