Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   R6I59_RS13390 Genome accession   NZ_CP139744
Coordinates   2556101..2556484 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis isolate FELIX_MS255     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2551101..2561484
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R6I59_RS13350 (R6I59_13350) sinI 2552035..2552208 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  R6I59_RS13355 (R6I59_13355) sinR 2552242..2552577 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  R6I59_RS13360 (R6I59_13360) tasA 2552670..2553455 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  R6I59_RS13365 (R6I59_13365) sipW 2553519..2554091 (-) 573 WP_003246088.1 signal peptidase I SipW -
  R6I59_RS13370 (R6I59_13370) tapA 2554075..2554836 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  R6I59_RS13375 (R6I59_13375) yqzG 2555108..2555434 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  R6I59_RS13380 (R6I59_13380) spoIITA 2555476..2555655 (-) 180 WP_003230176.1 YqzE family protein -
  R6I59_RS13385 (R6I59_13385) comGG 2555726..2556100 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  R6I59_RS13390 (R6I59_13390) comGF 2556101..2556484 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  R6I59_RS13395 (R6I59_13395) comGE 2556510..2556857 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  R6I59_RS13400 (R6I59_13400) comGD 2556841..2557272 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  R6I59_RS13405 (R6I59_13405) comGC 2557262..2557558 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  R6I59_RS13410 (R6I59_13410) comGB 2557572..2558609 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  R6I59_RS13415 (R6I59_13415) comGA 2558596..2559666 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  R6I59_RS13420 (R6I59_13420) corA 2560078..2561031 (-) 954 WP_032723504.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=910815 R6I59_RS13390 WP_003230168.1 2556101..2556484(-) (comGF) [Bacillus subtilis isolate FELIX_MS255]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=910815 R6I59_RS13390 WP_003230168.1 2556101..2556484(-) (comGF) [Bacillus subtilis isolate FELIX_MS255]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1