Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   R6Z04_RS13405 Genome accession   NZ_CP139440
Coordinates   2556174..2556557 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain GUCC4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2551174..2561557
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R6Z04_RS13365 (R6Z04_13365) sinI 2552108..2552281 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  R6Z04_RS13370 (R6Z04_13370) sinR 2552315..2552650 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  R6Z04_RS13375 (R6Z04_13375) tasA 2552743..2553528 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  R6Z04_RS13380 (R6Z04_13380) sipW 2553592..2554164 (-) 573 WP_003246088.1 signal peptidase I SipW -
  R6Z04_RS13385 (R6Z04_13385) tapA 2554148..2554909 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  R6Z04_RS13390 (R6Z04_13390) yqzG 2555181..2555507 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  R6Z04_RS13395 (R6Z04_13395) spoIITA 2555549..2555728 (-) 180 WP_003230176.1 YqzE family protein -
  R6Z04_RS13400 (R6Z04_13400) comGG 2555799..2556173 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  R6Z04_RS13405 (R6Z04_13405) comGF 2556174..2556557 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  R6Z04_RS13410 (R6Z04_13410) comGE 2556583..2556930 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  R6Z04_RS13415 (R6Z04_13415) comGD 2556914..2557345 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  R6Z04_RS13420 (R6Z04_13420) comGC 2557335..2557631 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  R6Z04_RS13425 (R6Z04_13425) comGB 2557645..2558682 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  R6Z04_RS13430 (R6Z04_13430) comGA 2558669..2559739 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  R6Z04_RS13435 (R6Z04_13435) corA 2560151..2561104 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=909791 R6Z04_RS13405 WP_003230168.1 2556174..2556557(-) (comGF) [Bacillus subtilis strain GUCC4]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=909791 R6Z04_RS13405 WP_003230168.1 2556174..2556557(-) (comGF) [Bacillus subtilis strain GUCC4]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1