Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   RJY17_RS03200 Genome accession   NZ_CP134692
Coordinates   583781..584047 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain B5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 578781..589047
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RJY17_RS03150 (RJY17_03150) sinR 578945..579280 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RJY17_RS03155 (RJY17_03155) tasA 579328..580113 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  RJY17_RS03160 (RJY17_03160) sipW 580178..580762 (-) 585 WP_015240205.1 signal peptidase I SipW -
  RJY17_RS03165 (RJY17_03165) tapA 580734..581405 (-) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  RJY17_RS03170 (RJY17_03170) - 581664..581993 (+) 330 WP_094032245.1 DUF3889 domain-containing protein -
  RJY17_RS03175 (RJY17_03175) - 582033..582212 (-) 180 WP_003153093.1 YqzE family protein -
  RJY17_RS03180 (RJY17_03180) comGG 582269..582646 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  RJY17_RS03185 (RJY17_03185) comGF 582647..583147 (-) 501 WP_254922226.1 competence type IV pilus minor pilin ComGF -
  RJY17_RS03190 (RJY17_03190) comGE 583056..583370 (-) 315 WP_094032244.1 competence type IV pilus minor pilin ComGE -
  RJY17_RS03195 (RJY17_03195) comGD 583354..583791 (-) 438 WP_094032243.1 competence type IV pilus minor pilin ComGD Machinery gene
  RJY17_RS03200 (RJY17_03200) comGC 583781..584047 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  RJY17_RS03205 (RJY17_03205) comGB 584094..585131 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  RJY17_RS03210 (RJY17_03210) comGA 585118..586188 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  RJY17_RS03215 (RJY17_03215) - 586381..587331 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -
  RJY17_RS03220 (RJY17_03220) - 587477..588778 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=882858 RJY17_RS03200 WP_042635730.1 583781..584047(-) (comGC) [Bacillus velezensis strain B5]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=882858 RJY17_RS03200 WP_042635730.1 583781..584047(-) (comGC) [Bacillus velezensis strain B5]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602