Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   K6J86_RS13160 Genome accession   NZ_AP024627
Coordinates   2528725..2529108 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain BEST3136     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2523725..2534108
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K6J86_RS13120 (BsBEST3136_25290) sinI 2524659..2524832 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  K6J86_RS13125 (BsBEST3136_25300) sinR 2524866..2525201 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  K6J86_RS13130 (BsBEST3136_25310) tasA 2525294..2526079 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  K6J86_RS13135 (BsBEST3136_25320) sipW 2526143..2526715 (-) 573 WP_003246088.1 signal peptidase I SipW -
  K6J86_RS13140 (BsBEST3136_25330) tapA 2526699..2527460 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  K6J86_RS13145 (BsBEST3136_25340) yqzG 2527732..2528058 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  K6J86_RS13150 (BsBEST3136_25350) spoIITA 2528100..2528279 (-) 180 WP_003230176.1 YqzE family protein -
  K6J86_RS13155 (BsBEST3136_25360) comGG 2528350..2528724 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  K6J86_RS13160 (BsBEST3136_25370) comGF 2528725..2529108 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  K6J86_RS13165 (BsBEST3136_25380) comGE 2529134..2529481 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  K6J86_RS13170 (BsBEST3136_25390) comGD 2529465..2529896 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  K6J86_RS13175 (BsBEST3136_25400) comGC 2529886..2530182 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  K6J86_RS13180 (BsBEST3136_25410) comGB 2530196..2531233 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  K6J86_RS13185 (BsBEST3136_25420) comGA 2531220..2532290 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  K6J86_RS13190 (BsBEST3136_25430) corA 2532702..2533655 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=87292 K6J86_RS13160 WP_003230168.1 2528725..2529108(-) (comGF) [Bacillus subtilis strain BEST3136]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=87292 K6J86_RS13160 WP_003230168.1 2528725..2529108(-) (comGF) [Bacillus subtilis strain BEST3136]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment