Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   WHO18_RS13410 Genome accession   NZ_CP148128
Coordinates   2556098..2556481 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   P25958
Organism   Bacillus subtilis isolate FELIX_MS620     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2551098..2561481
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO18_RS13370 sinI 2552032..2552205 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WHO18_RS13375 sinR 2552239..2552574 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WHO18_RS13380 tasA 2552667..2553452 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  WHO18_RS13385 sipW 2553516..2554088 (-) 573 WP_003246088.1 signal peptidase I -
  WHO18_RS13390 tapA 2554072..2554833 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  WHO18_RS13395 yqzG 2555105..2555431 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WHO18_RS13400 spoIIT 2555473..2555652 (-) 180 WP_003230176.1 YqzE family protein -
  WHO18_RS13405 comGG 2555723..2556097 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  WHO18_RS13410 comGF 2556098..2556481 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  WHO18_RS13415 comGE 2556507..2556854 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  WHO18_RS13420 comGD 2556838..2557269 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  WHO18_RS13425 comGC 2557259..2557555 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  WHO18_RS13430 comGB 2557569..2558606 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  WHO18_RS13435 comGA 2558593..2559663 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  WHO18_RS13440 corA 2560075..2561028 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=865831 WHO18_RS13410 WP_003230168.1 2556098..2556481(-) (comGF) [Bacillus subtilis isolate FELIX_MS620]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=865831 WHO18_RS13410 WP_003230168.1 2556098..2556481(-) (comGF) [Bacillus subtilis isolate FELIX_MS620]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25958

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1