Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   WHO38_RS13385 Genome accession   NZ_CP148124
Coordinates   2555243..2555626 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   P25958
Organism   Bacillus subtilis isolate FELIX_MS521     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2550243..2560626
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO38_RS13345 sinI 2551177..2551350 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WHO38_RS13350 sinR 2551384..2551719 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WHO38_RS13355 tasA 2551812..2552597 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  WHO38_RS13360 sipW 2552661..2553233 (-) 573 WP_003246088.1 signal peptidase I -
  WHO38_RS13365 tapA 2553217..2553978 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  WHO38_RS13370 yqzG 2554250..2554576 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WHO38_RS13375 spoIIT 2554618..2554797 (-) 180 WP_003230176.1 YqzE family protein -
  WHO38_RS13380 comGG 2554868..2555242 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  WHO38_RS13385 comGF 2555243..2555626 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  WHO38_RS13390 comGE 2555652..2555999 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  WHO38_RS13395 comGD 2555983..2556414 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  WHO38_RS13400 comGC 2556404..2556700 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  WHO38_RS13405 comGB 2556714..2557751 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  WHO38_RS13410 comGA 2557738..2558808 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  WHO38_RS13415 corA 2559220..2560173 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=865591 WHO38_RS13385 WP_003230168.1 2555243..2555626(-) (comGF) [Bacillus subtilis isolate FELIX_MS521]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=865591 WHO38_RS13385 WP_003230168.1 2555243..2555626(-) (comGF) [Bacillus subtilis isolate FELIX_MS521]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25958

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1