Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   Q4I20_RS13390 Genome accession   NZ_CP130597
Coordinates   2556548..2556931 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain NCIB_3610     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2551548..2561931
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q4I20_RS13350 (Q4I20_13345) sinI 2552482..2552655 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  Q4I20_RS13355 (Q4I20_13350) sinR 2552689..2553024 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  Q4I20_RS13360 (Q4I20_13355) tasA 2553117..2553902 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  Q4I20_RS13365 (Q4I20_13360) sipW 2553966..2554538 (-) 573 WP_003246088.1 signal peptidase I SipW -
  Q4I20_RS13370 (Q4I20_13365) tapA 2554522..2555283 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  Q4I20_RS13375 (Q4I20_13370) yqzG 2555555..2555881 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  Q4I20_RS13380 (Q4I20_13375) spoIITA 2555923..2556102 (-) 180 WP_003230176.1 YqzE family protein -
  Q4I20_RS13385 (Q4I20_13380) comGG 2556173..2556547 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  Q4I20_RS13390 (Q4I20_13385) comGF 2556548..2556931 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  Q4I20_RS13395 (Q4I20_13390) comGE 2556957..2557304 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  Q4I20_RS13400 (Q4I20_13395) comGD 2557288..2557719 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  Q4I20_RS13405 (Q4I20_13400) comGC 2557709..2558005 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  Q4I20_RS13410 (Q4I20_13405) comGB 2558019..2559056 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  Q4I20_RS13415 (Q4I20_13410) comGA 2559043..2560113 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  Q4I20_RS13420 (Q4I20_13415) corA 2560525..2561478 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=860459 Q4I20_RS13390 WP_003230168.1 2556548..2556931(-) (comGF) [Bacillus subtilis strain NCIB_3610]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=860459 Q4I20_RS13390 WP_003230168.1 2556548..2556931(-) (comGF) [Bacillus subtilis strain NCIB_3610]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1