Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   Q2310_RS18945 Genome accession   NZ_CP130491
Coordinates   3733473..3734252 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus cereus strain T     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3708176..3769941 3733473..3734252 within 0


Gene organization within MGE regions


Location: 3708176..3769941
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q2310_RS18835 (Q2310_18795) - 3708747..3709646 (-) 900 WP_000868224.1 polysaccharide deacetylase family protein -
  Q2310_RS18840 (Q2310_18800) pnp 3709800..3711938 (-) 2139 WP_000076737.1 polyribonucleotide nucleotidyltransferase -
  Q2310_RS18845 (Q2310_18805) rpsO 3712099..3712368 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  Q2310_RS18850 (Q2310_18810) ribF 3712469..3713440 (-) 972 WP_000766706.1 bifunctional riboflavin kinase/FAD synthetase -
  Q2310_RS18855 (Q2310_18815) truB 3713484..3714407 (-) 924 WP_000399350.1 tRNA pseudouridine(55) synthase TruB -
  Q2310_RS18860 (Q2310_18820) rbfA 3714494..3714850 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  Q2310_RS18865 (Q2310_18825) - 3714866..3715147 (-) 282 WP_000582363.1 DUF503 domain-containing protein -
  Q2310_RS18870 (Q2310_18830) infB 3715144..3717204 (-) 2061 WP_000036343.1 translation initiation factor IF-2 -
  Q2310_RS18875 (Q2310_18835) - 3717209..3717520 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  Q2310_RS18880 (Q2310_18840) rnpM 3717521..3717793 (-) 273 WP_000071127.1 RNase P modulator RnpM -
  Q2310_RS18885 (Q2310_18845) nusA 3717805..3718911 (-) 1107 WP_000102604.1 transcription termination factor NusA -
  Q2310_RS18890 (Q2310_18850) rimP 3718929..3719399 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  Q2310_RS18895 (Q2310_18855) - 3719736..3724037 (-) 4302 WP_000060005.1 PolC-type DNA polymerase III -
  Q2310_RS18900 (Q2310_18860) - 3724162..3725862 (-) 1701 WP_000814309.1 proline--tRNA ligase -
  Q2310_RS18905 (Q2310_18865) rseP 3725972..3727228 (-) 1257 WP_001090243.1 RIP metalloprotease RseP -
  Q2310_RS18910 (Q2310_18870) dxr 3727246..3728388 (-) 1143 WP_000790373.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  Q2310_RS18915 (Q2310_18875) cdsA 3728412..3729203 (-) 792 WP_000813594.1 phosphatidate cytidylyltransferase -
  Q2310_RS18920 (Q2310_18880) uppS 3729221..3729997 (-) 777 WP_000971296.1 isoprenyl transferase -
  Q2310_RS18925 (Q2310_18885) frr 3730083..3730640 (-) 558 WP_000531501.1 ribosome recycling factor -
  Q2310_RS18930 (Q2310_18890) pyrH 3730643..3731365 (-) 723 WP_000042668.1 UMP kinase -
  Q2310_RS18935 (Q2310_18895) tsf 3731432..3732319 (-) 888 WP_001018578.1 translation elongation factor Ts -
  Q2310_RS18940 (Q2310_18900) rpsB 3732423..3733124 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  Q2310_RS18945 (Q2310_18905) codY 3733473..3734252 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  Q2310_RS18950 (Q2310_18910) hslU 3734330..3735721 (-) 1392 WP_000550078.1 ATP-dependent protease ATPase subunit HslU -
  Q2310_RS18955 (Q2310_18915) hslV 3735744..3736286 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  Q2310_RS18960 (Q2310_18920) xerC 3736329..3737228 (-) 900 WP_061113702.1 tyrosine recombinase XerC -
  Q2310_RS18965 (Q2310_18925) trmFO 3737294..3738598 (-) 1305 WP_000213002.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  Q2310_RS18970 (Q2310_18930) topA 3738647..3740725 (-) 2079 WP_001286963.1 type I DNA topoisomerase -
  Q2310_RS18975 (Q2310_18935) dprA 3740870..3741739 (-) 870 WP_000818043.1 DNA-processing protein DprA -
  Q2310_RS18980 (Q2310_18940) sucD 3741828..3742730 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  Q2310_RS18985 (Q2310_18945) sucC 3742750..3743910 (-) 1161 WP_001020791.1 ADP-forming succinate--CoA ligase subunit beta -
  Q2310_RS18990 (Q2310_18950) - 3744105..3744878 (-) 774 WP_001194265.1 ribonuclease HII -
  Q2310_RS18995 (Q2310_18955) ylqF 3744935..3745825 (-) 891 WP_000236704.1 ribosome biogenesis GTPase YlqF -
  Q2310_RS19000 (Q2310_18960) lepB 3745846..3746397 (-) 552 WP_000711853.1 signal peptidase I -
  Q2310_RS19005 (Q2310_18965) rplS 3746499..3746843 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  Q2310_RS19010 (Q2310_18970) trmD 3746990..3747724 (-) 735 WP_061113701.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  Q2310_RS19015 (Q2310_18975) rimM 3747724..3748239 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  Q2310_RS19020 (Q2310_18980) - 3748361..3748588 (-) 228 WP_000737401.1 KH domain-containing protein -
  Q2310_RS19025 (Q2310_18985) rpsP 3748603..3748875 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  Q2310_RS19030 (Q2310_18990) ffh 3748977..3750326 (-) 1350 WP_000863460.1 signal recognition particle protein -
  Q2310_RS19035 (Q2310_18995) - 3750339..3750671 (-) 333 WP_000891062.1 putative DNA-binding protein -
  Q2310_RS19040 (Q2310_19000) ftsY 3750805..3751764 (-) 960 WP_316272274.1 signal recognition particle-docking protein FtsY -
  Q2310_RS19045 (Q2310_19005) smc 3751811..3755380 (-) 3570 WP_061113700.1 chromosome segregation protein SMC -
  Q2310_RS19050 (Q2310_19010) rncS 3755527..3756264 (-) 738 WP_001146875.1 ribonuclease III -
  Q2310_RS19055 (Q2310_19015) acpP 3756323..3756556 (-) 234 WP_000786062.1 acyl carrier protein -
  Q2310_RS19060 (Q2310_19020) fabG 3756626..3757366 (-) 741 WP_000911773.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  Q2310_RS19065 (Q2310_19025) fabD 3757366..3758310 (-) 945 WP_000515900.1 ACP S-malonyltransferase -
  Q2310_RS19070 (Q2310_19030) plsX 3758325..3759317 (-) 993 WP_000684100.1 phosphate acyltransferase PlsX -
  Q2310_RS19075 (Q2310_19035) fapR 3759314..3759908 (-) 595 Protein_3699 transcription factor FapR -
  Q2310_RS19080 (Q2310_19040) recG 3759997..3762045 (-) 2049 WP_001000813.1 ATP-dependent DNA helicase RecG -
  Q2310_RS19085 (Q2310_19045) - 3762336..3764012 (-) 1677 WP_000027129.1 DAK2 domain-containing protein -
  Q2310_RS19090 (Q2310_19050) - 3764035..3764397 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  Q2310_RS19095 (Q2310_19055) rpmB 3764774..3764962 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  Q2310_RS19100 (Q2310_19060) spoVM 3765036..3765116 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  Q2310_RS19105 (Q2310_19065) - 3765183..3765863 (-) 681 WP_000752663.1 thiamine diphosphokinase -
  Q2310_RS19110 (Q2310_19070) rpe 3765933..3766577 (-) 645 WP_000589974.1 ribulose-phosphate 3-epimerase -
  Q2310_RS19115 (Q2310_19075) rsgA 3766580..3767461 (-) 882 WP_001113932.1 ribosome small subunit-dependent GTPase A -
  Q2310_RS19120 (Q2310_19080) pknB 3767708..3769681 (-) 1974 WP_000904748.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=858650 Q2310_RS18945 WP_000421290.1 3733473..3734252(-) (codY) [Bacillus cereus strain T]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=858650 Q2310_RS18945 WP_000421290.1 3733473..3734252(-) (codY) [Bacillus cereus strain T]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCGCGTAGTAAAGCTGTTGTTCAAATGGCAATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GCTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAAGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459