Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   QPK55_RS19075 Genome accession   NZ_CP130284
Coordinates   3800110..3800889 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus cereus strain Z4     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3774817..3836575 3800110..3800889 within 0


Gene organization within MGE regions


Location: 3774817..3836575
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QPK55_RS18965 (QPK55_18955) - 3775387..3776286 (-) 900 WP_000868217.1 polysaccharide deacetylase family protein -
  QPK55_RS18970 (QPK55_18960) pnp 3776438..3778576 (-) 2139 WP_000076737.1 polyribonucleotide nucleotidyltransferase -
  QPK55_RS18975 (QPK55_18965) rpsO 3778737..3779006 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  QPK55_RS18980 (QPK55_18970) ribF 3779107..3780078 (-) 972 WP_000766706.1 bifunctional riboflavin kinase/FAD synthetase -
  QPK55_RS18985 (QPK55_18975) truB 3780122..3781045 (-) 924 WP_000399352.1 tRNA pseudouridine(55) synthase TruB -
  QPK55_RS18990 (QPK55_18980) rbfA 3781132..3781488 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  QPK55_RS18995 (QPK55_18985) - 3781504..3781785 (-) 282 WP_000582363.1 DUF503 domain-containing protein -
  QPK55_RS19000 (QPK55_18990) infB 3781782..3783842 (-) 2061 WP_000036343.1 translation initiation factor IF-2 -
  QPK55_RS19005 (QPK55_18995) - 3783847..3784158 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  QPK55_RS19010 (QPK55_19000) rnpM 3784159..3784431 (-) 273 WP_000071127.1 RNase P modulator RnpM -
  QPK55_RS19015 (QPK55_19005) nusA 3784443..3785549 (-) 1107 WP_000102604.1 transcription termination factor NusA -
  QPK55_RS19020 (QPK55_19010) rimP 3785567..3786037 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  QPK55_RS19025 (QPK55_19015) - 3786374..3790675 (-) 4302 WP_000060005.1 PolC-type DNA polymerase III -
  QPK55_RS19030 (QPK55_19020) - 3790800..3792500 (-) 1701 WP_000814302.1 proline--tRNA ligase -
  QPK55_RS19035 (QPK55_19025) rseP 3792610..3793866 (-) 1257 WP_001090251.1 RIP metalloprotease RseP -
  QPK55_RS19040 (QPK55_19030) dxr 3793884..3795026 (-) 1143 WP_000790373.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  QPK55_RS19045 (QPK55_19035) cdsA 3795050..3795841 (-) 792 WP_000813592.1 phosphatidate cytidylyltransferase -
  QPK55_RS19050 (QPK55_19040) uppS 3795859..3796635 (-) 777 WP_000971296.1 isoprenyl transferase -
  QPK55_RS19055 (QPK55_19045) frr 3796721..3797278 (-) 558 WP_000531501.1 ribosome recycling factor -
  QPK55_RS19060 (QPK55_19050) pyrH 3797281..3798003 (-) 723 WP_000042668.1 UMP kinase -
  QPK55_RS19065 (QPK55_19055) tsf 3798070..3798957 (-) 888 WP_001018578.1 translation elongation factor Ts -
  QPK55_RS19070 (QPK55_19060) rpsB 3799061..3799762 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  QPK55_RS19075 (QPK55_19065) codY 3800110..3800889 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  QPK55_RS19080 (QPK55_19070) hslU 3800967..3802358 (-) 1392 WP_000550078.1 ATP-dependent protease ATPase subunit HslU -
  QPK55_RS19085 (QPK55_19075) hslV 3802381..3802923 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  QPK55_RS19090 (QPK55_19080) xerC 3802966..3803865 (-) 900 WP_001101243.1 tyrosine recombinase XerC -
  QPK55_RS19095 (QPK55_19085) trmFO 3803931..3805235 (-) 1305 WP_000213002.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  QPK55_RS19100 (QPK55_19090) topA 3805284..3807362 (-) 2079 WP_001286963.1 type I DNA topoisomerase -
  QPK55_RS19105 (QPK55_19095) dprA 3807507..3808376 (-) 870 WP_000196438.1 DNA-processing protein DprA -
  QPK55_RS19110 (QPK55_19100) sucD 3808465..3809367 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  QPK55_RS19115 (QPK55_19105) sucC 3809387..3810547 (-) 1161 WP_001020791.1 ADP-forming succinate--CoA ligase subunit beta -
  QPK55_RS19120 (QPK55_19110) - 3810742..3811515 (-) 774 WP_001194265.1 ribonuclease HII -
  QPK55_RS19125 (QPK55_19115) ylqF 3811572..3812462 (-) 891 WP_000236704.1 ribosome biogenesis GTPase YlqF -
  QPK55_RS19130 (QPK55_19120) lepB 3812483..3813034 (-) 552 WP_000711853.1 signal peptidase I -
  QPK55_RS19135 (QPK55_19125) rplS 3813136..3813480 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  QPK55_RS19140 (QPK55_19130) trmD 3813627..3814361 (-) 735 WP_000686903.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  QPK55_RS19145 (QPK55_19135) rimM 3814361..3814876 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  QPK55_RS19150 (QPK55_19140) - 3814998..3815225 (-) 228 WP_000737401.1 KH domain-containing protein -
  QPK55_RS19155 (QPK55_19145) rpsP 3815240..3815512 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  QPK55_RS19160 (QPK55_19150) ffh 3815614..3816963 (-) 1350 WP_000863460.1 signal recognition particle protein -
  QPK55_RS19165 (QPK55_19155) - 3816976..3817308 (-) 333 WP_000891062.1 putative DNA-binding protein -
  QPK55_RS19170 (QPK55_19160) ftsY 3817442..3818431 (-) 990 WP_000007655.1 signal recognition particle-docking protein FtsY -
  QPK55_RS19175 (QPK55_19165) smc 3818447..3822016 (-) 3570 WP_000478973.1 chromosome segregation protein SMC -
  QPK55_RS19180 (QPK55_19170) rncS 3822163..3822900 (-) 738 WP_001146875.1 ribonuclease III -
  QPK55_RS19185 (QPK55_19175) acpP 3822959..3823192 (-) 234 WP_000786062.1 acyl carrier protein -
  QPK55_RS19190 (QPK55_19180) fabG 3823262..3824002 (-) 741 WP_000911773.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  QPK55_RS19195 (QPK55_19185) fabD 3824002..3824946 (-) 945 WP_000515899.1 ACP S-malonyltransferase -
  QPK55_RS19200 (QPK55_19190) plsX 3824961..3825953 (-) 993 WP_000684100.1 phosphate acyltransferase PlsX -
  QPK55_RS19205 (QPK55_19195) fapR 3825950..3826543 (-) 594 WP_000747348.1 transcription factor FapR -
  QPK55_RS19210 (QPK55_19200) recG 3826632..3828680 (-) 2049 WP_001000816.1 ATP-dependent DNA helicase RecG -
  QPK55_RS19215 (QPK55_19205) - 3828971..3830647 (-) 1677 WP_000027129.1 DAK2 domain-containing protein -
  QPK55_RS19220 (QPK55_19210) - 3830670..3831032 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  QPK55_RS19225 (QPK55_19215) rpmB 3831409..3831597 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  QPK55_RS19230 (QPK55_19220) spoVM 3831671..3831751 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  QPK55_RS19235 (QPK55_19225) - 3831818..3832498 (-) 681 WP_002026234.1 thiamine diphosphokinase -
  QPK55_RS19240 (QPK55_19230) rpe 3832567..3833211 (-) 645 WP_000589974.1 ribulose-phosphate 3-epimerase -
  QPK55_RS19245 (QPK55_19235) rsgA 3833214..3834095 (-) 882 WP_001113932.1 ribosome small subunit-dependent GTPase A -
  QPK55_RS19250 (QPK55_19240) pknB 3834342..3836315 (-) 1974 WP_000904747.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=857646 QPK55_RS19075 WP_000421290.1 3800110..3800889(-) (codY) [Bacillus cereus strain Z4]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=857646 QPK55_RS19075 WP_000421290.1 3800110..3800889(-) (codY) [Bacillus cereus strain Z4]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCGCGTAGTAAAGCTGTTGTTCAAATGGCAATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GCTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAAGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459