Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   QRA03_RS03455 Genome accession   NZ_CP129604
Coordinates   615420..616199 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus paranthracis strain PUMB_17     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 588799..634831 615420..616199 within 0


Gene organization within MGE regions


Location: 588799..634831
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QRA03_RS03335 (QRA03_03335) - 588993..589244 (-) 252 WP_001239754.1 YlmC/YmxH family sporulation protein -
  QRA03_RS03340 (QRA03_03340) - 589371..590612 (-) 1242 WP_000592995.1 pitrilysin family protein -
  QRA03_RS03345 (QRA03_03345) - 590699..591598 (-) 900 WP_000647527.1 polysaccharide deacetylase family protein -
  QRA03_RS03350 (QRA03_03350) pnp 591750..593888 (-) 2139 WP_000076746.1 polyribonucleotide nucleotidyltransferase -
  QRA03_RS03355 (QRA03_03355) rpsO 594049..594318 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  QRA03_RS03360 (QRA03_03360) ribF 594419..595390 (-) 972 WP_000766710.1 bifunctional riboflavin kinase/FAD synthetase -
  QRA03_RS03365 (QRA03_03365) truB 595434..596357 (-) 924 WP_000399344.1 tRNA pseudouridine(55) synthase TruB -
  QRA03_RS03370 (QRA03_03370) rbfA 596444..596800 (-) 357 WP_000776440.1 30S ribosome-binding factor RbfA -
  QRA03_RS03375 (QRA03_03375) - 596816..597097 (-) 282 WP_000582364.1 DUF503 family protein -
  QRA03_RS03380 (QRA03_03380) infB 597094..599154 (-) 2061 WP_000036342.1 translation initiation factor IF-2 -
  QRA03_RS03385 (QRA03_03385) - 599159..599470 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  QRA03_RS03390 (QRA03_03390) - 599471..599743 (-) 273 WP_000071128.1 YlxR family protein -
  QRA03_RS03395 (QRA03_03395) nusA 599755..600861 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  QRA03_RS03400 (QRA03_03400) rimP 600879..601349 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  QRA03_RS03405 (QRA03_03405) - 601682..605983 (-) 4302 WP_000059980.1 PolC-type DNA polymerase III -
  QRA03_RS03410 (QRA03_03410) - 606108..607808 (-) 1701 WP_000814305.1 proline--tRNA ligase -
  QRA03_RS03415 (QRA03_03415) rseP 607918..609174 (-) 1257 WP_001090248.1 RIP metalloprotease RseP -
  QRA03_RS03420 (QRA03_03420) dxr 609191..610333 (-) 1143 WP_000790362.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  QRA03_RS03425 (QRA03_03425) cdsA 610357..611148 (-) 792 WP_000813584.1 phosphatidate cytidylyltransferase -
  QRA03_RS03430 (QRA03_03430) uppS 611166..611942 (-) 777 WP_000971301.1 isoprenyl transferase -
  QRA03_RS03435 (QRA03_03435) frr 612028..612585 (-) 558 WP_000531500.1 ribosome recycling factor -
  QRA03_RS03440 (QRA03_03440) pyrH 612588..613310 (-) 723 WP_000042663.1 UMP kinase -
  QRA03_RS03445 (QRA03_03445) tsf 613377..614264 (-) 888 WP_001018580.1 translation elongation factor Ts -
  QRA03_RS03450 (QRA03_03450) rpsB 614368..615069 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  QRA03_RS03455 (QRA03_03455) codY 615420..616199 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  QRA03_RS03460 (QRA03_03460) hslU 616277..617668 (-) 1392 WP_000550081.1 ATP-dependent protease ATPase subunit HslU -
  QRA03_RS03465 (QRA03_03465) hslV 617691..618233 (-) 543 WP_000526271.1 ATP-dependent protease proteolytic subunit HslV -
  QRA03_RS03470 (QRA03_03470) xerC 618276..619175 (-) 900 WP_001101229.1 tyrosine recombinase XerC -
  QRA03_RS03475 (QRA03_03475) trmFO 619241..620545 (-) 1305 WP_002028254.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  QRA03_RS03480 (QRA03_03480) topA 620596..622674 (-) 2079 WP_001286973.1 type I DNA topoisomerase -
  QRA03_RS03485 (QRA03_03485) dprA 622819..623688 (-) 870 WP_000818031.1 DNA-processing protein DprA -
  QRA03_RS03490 (QRA03_03490) sucD 623776..624678 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  QRA03_RS03495 (QRA03_03495) sucC 624698..625858 (-) 1161 WP_001020785.1 ADP-forming succinate--CoA ligase subunit beta -
  QRA03_RS03500 (QRA03_03500) rnhB 626052..626825 (-) 774 WP_001174725.1 ribonuclease HII -
  QRA03_RS03505 (QRA03_03505) ylqF 626877..627767 (-) 891 WP_048539089.1 ribosome biogenesis GTPase YlqF -
  QRA03_RS03510 (QRA03_03510) lepB 627788..628339 (-) 552 WP_000711857.1 signal peptidase I -
  QRA03_RS03515 (QRA03_03515) rplS 628441..628785 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  QRA03_RS03520 (QRA03_03520) trmD 628932..629666 (-) 735 WP_000686911.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  QRA03_RS03525 (QRA03_03525) rimM 629666..630181 (-) 516 WP_000170268.1 ribosome maturation factor RimM -
  QRA03_RS03530 (QRA03_03530) - 630302..630529 (-) 228 WP_048539088.1 KH domain-containing protein -
  QRA03_RS03535 (QRA03_03535) rpsP 630544..630816 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  QRA03_RS03540 (QRA03_03540) ffh 630917..632266 (-) 1350 WP_048539086.1 signal recognition particle protein -
  QRA03_RS03545 (QRA03_03545) - 632279..632611 (-) 333 WP_000891062.1 putative DNA-binding protein -
  QRA03_RS03550 (QRA03_03550) ftsY 632745..633734 (-) 990 WP_000007646.1 signal recognition particle-docking protein FtsY -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=854497 QRA03_RS03455 WP_000421288.1 615420..616199(-) (codY) [Bacillus paranthracis strain PUMB_17]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=854497 QRA03_RS03455 WP_000421288.1 615420..616199(-) (codY) [Bacillus paranthracis strain PUMB_17]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAGCGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGCTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATTGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTACTAAACGACAAATTCTTACATGAACTTGCTAAATTGAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459