Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   V6U64_RS00815 Genome accession   NZ_CP145862
Coordinates   156333..156563 (+) Length   76 a.a.
NCBI ID   WP_021144685.1    Uniprot ID   -
Organism   Streptococcus salivarius strain KSS4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 151333..161563
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6U64_RS00790 (V6U64_00790) - 153225..153587 (+) 363 WP_014635121.1 DUF1033 family protein -
  V6U64_RS00795 (V6U64_00795) comGA/cglA/cilD 153667..154608 (+) 942 WP_002887018.1 competence type IV pilus ATPase ComGA Machinery gene
  V6U64_RS00800 (V6U64_00800) comGB 154490..155590 (+) 1101 WP_148263031.1 competence type IV pilus assembly protein ComGB Machinery gene
  V6U64_RS00805 (V6U64_00805) comGC 155599..155913 (+) 315 WP_037611125.1 competence type IV pilus major pilin ComGC Machinery gene
  V6U64_RS00810 (V6U64_00810) comGD 155873..156301 (+) 429 WP_270334813.1 competence type IV pilus minor pilin ComGD Machinery gene
  V6U64_RS00815 (V6U64_00815) comGE 156333..156563 (+) 231 WP_021144685.1 competence type IV pilus minor pilin ComGE Machinery gene
  V6U64_RS00820 (V6U64_00820) comGF 156550..156987 (+) 438 WP_227071977.1 competence type IV pilus minor pilin ComGF Machinery gene
  V6U64_RS00825 (V6U64_00825) comGG 156965..157282 (+) 318 WP_227071976.1 competence type IV pilus minor pilin ComGG Machinery gene
  V6U64_RS00830 (V6U64_00830) comGH 157327..158283 (+) 957 WP_227071975.1 class I SAM-dependent methyltransferase Machinery gene
  V6U64_RS00835 (V6U64_00835) - 158340..159533 (+) 1194 WP_002885831.1 acetate kinase -
  V6U64_RS00840 (V6U64_00840) - 159786..159983 (+) 198 WP_002885716.1 helix-turn-helix transcriptional regulator -
  V6U64_RS00845 (V6U64_00845) - 159995..160591 (+) 597 WP_410536720.1 CPBP family intramembrane glutamic endopeptidase -
  V6U64_RS00850 (V6U64_00850) - 160731..161177 (+) 447 WP_073686090.1 CAAX protease -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8413.85 Da        Isoelectric Point: 10.4655

>NTDB_id=853343 V6U64_RS00815 WP_021144685.1 156333..156563(+) (comGE) [Streptococcus salivarius strain KSS4]
MAVLVLVSGLILEQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSKQGIAVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=853343 V6U64_RS00815 WP_021144685.1 156333..156563(+) (comGE) [Streptococcus salivarius strain KSS4]
ATGGCTGTTTTAGTACTTGTCAGTGGTCTTATTTTGGAACAAATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCAACCATGGCAGTTCAGACAAAACAGGATCAGTTGACCTTAAATGGCATCACAGTGA
CAGTTAAACGTAGCAAGCAAGGTATCGCGGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

37.838

97.368

0.368

  comGE Streptococcus mutans UA159

37.838

97.368

0.368