Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   QWD88_RS07795 Genome accession   NZ_CP129120
Coordinates   1490619..1490933 (+) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM126718     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1485619..1495933
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QWD88_RS07770 (QWD88_07770) - 1486654..1487604 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  QWD88_RS07775 (QWD88_07775) comGA 1487801..1488871 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  QWD88_RS07780 (QWD88_07780) comGB 1488858..1489895 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  QWD88_RS07785 (QWD88_07785) comGC 1489942..1490208 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  QWD88_RS07790 (QWD88_07790) comGD 1490198..1490635 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  QWD88_RS07795 (QWD88_07795) comGE 1490619..1490933 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  QWD88_RS07800 (QWD88_07800) comGF 1490878..1491342 (+) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  QWD88_RS07805 (QWD88_07805) comGG 1491343..1491720 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  QWD88_RS07810 (QWD88_07810) - 1491777..1491956 (+) 180 WP_022552966.1 YqzE family protein -
  QWD88_RS07815 (QWD88_07815) - 1491997..1492326 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  QWD88_RS07820 (QWD88_07820) tapA 1492585..1493256 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  QWD88_RS07825 (QWD88_07825) sipW 1493228..1493812 (+) 585 WP_032874025.1 signal peptidase I SipW -
  QWD88_RS07830 (QWD88_07830) tasA 1493877..1494662 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  QWD88_RS07835 (QWD88_07835) sinR 1494710..1495045 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QWD88_RS07840 (QWD88_07840) sinI 1495079..1495252 (-) 174 WP_032874029.1 anti-repressor SinI Regulator

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=851104 QWD88_RS07795 WP_032874016.1 1490619..1490933(+) (comGE) [Bacillus velezensis strain SRCM126718]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=851104 QWD88_RS07795 WP_032874016.1 1490619..1490933(+) (comGE) [Bacillus velezensis strain SRCM126718]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481