Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   QVX78_RS11715 Genome accession   NZ_CP128992
Coordinates   2439930..2440244 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain ZLP-101     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2434930..2445244
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QVX78_RS11670 (QVX78_11655) sinI 2435611..2435784 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  QVX78_RS11675 (QVX78_11660) sinR 2435818..2436153 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QVX78_RS11680 (QVX78_11665) tasA 2436201..2436986 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  QVX78_RS11685 (QVX78_11670) sipW 2437051..2437635 (-) 585 WP_032874025.1 signal peptidase I SipW -
  QVX78_RS11690 (QVX78_11675) tapA 2437607..2438278 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  QVX78_RS11695 (QVX78_11680) - 2438537..2438866 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  QVX78_RS11700 (QVX78_11685) - 2438907..2439086 (-) 180 WP_022552966.1 YqzE family protein -
  QVX78_RS11705 (QVX78_11690) comGG 2439143..2439520 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  QVX78_RS11710 (QVX78_11695) comGF 2439521..2440021 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  QVX78_RS11715 (QVX78_11700) comGE 2439930..2440244 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  QVX78_RS11720 (QVX78_11705) comGD 2440228..2440665 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  QVX78_RS11725 (QVX78_11710) comGC 2440655..2440963 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  QVX78_RS11730 (QVX78_11715) comGB 2440968..2442005 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  QVX78_RS11735 (QVX78_11720) comGA 2441992..2443062 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  QVX78_RS11740 (QVX78_11725) - 2443259..2444209 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=850281 QVX78_RS11715 WP_032874016.1 2439930..2440244(-) (comGE) [Bacillus velezensis strain ZLP-101]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=850281 QVX78_RS11715 WP_032874016.1 2439930..2440244(-) (comGE) [Bacillus velezensis strain ZLP-101]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481