Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   V5G22_RS16120 Genome accession   NZ_CP144920
Coordinates   3160052..3160423 (+) Length   123 a.a.
NCBI ID   WP_003183461.1    Uniprot ID   -
Organism   Bacillus licheniformis strain CP26     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3155052..3165423
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V5G22_RS16080 (V5G22_16080) - 3155242..3155619 (+) 378 WP_003183482.1 Spx/MgsR family RNA polymerase-binding regulatory protein -
  V5G22_RS16090 (V5G22_16090) - 3155861..3156700 (+) 840 WP_003183480.1 STAS domain-containing protein -
  V5G22_RS16095 (V5G22_16095) comGA 3156857..3157921 (+) 1065 WP_003183477.1 competence type IV pilus ATPase ComGA Machinery gene
  V5G22_RS16100 (V5G22_16100) comGB 3157911..3158945 (+) 1035 WP_011198115.1 competence type IV pilus assembly protein ComGB Machinery gene
  V5G22_RS16105 (V5G22_16105) comGC 3158959..3159252 (+) 294 WP_003183466.1 competence type IV pilus major pilin ComGC Machinery gene
  V5G22_RS16110 (V5G22_16110) comGD 3159258..3159695 (+) 438 WP_009327905.1 competence type IV pilus minor pilin ComGD Machinery gene
  V5G22_RS16115 (V5G22_16115) comGE 3159679..3160026 (+) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -
  V5G22_RS16120 (V5G22_16120) comGF 3160052..3160423 (+) 372 WP_003183461.1 competence type IV pilus minor pilin ComGF Machinery gene
  V5G22_RS16125 (V5G22_16125) comGG 3160436..3160801 (+) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  V5G22_RS16130 (V5G22_16130) - 3160890..3161072 (+) 183 WP_003183456.1 YqzE family protein -
  V5G22_RS16135 (V5G22_16135) - 3161096..3161383 (-) 288 WP_223307118.1 YqzG/YhdC family protein -
  V5G22_RS16140 (V5G22_16140) tapA 3161693..3162421 (+) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  V5G22_RS16145 (V5G22_16145) - 3162418..3163002 (+) 585 WP_003183449.1 signal peptidase I -
  V5G22_RS16150 (V5G22_16150) - 3163076..3163870 (+) 795 WP_003183447.1 TasA family protein -
  V5G22_RS16155 (V5G22_16155) sinR 3163975..3164310 (-) 336 WP_006637528.1 helix-turn-helix domain-containing protein Regulator
  V5G22_RS16160 (V5G22_16160) sinI 3164344..3164520 (-) 177 WP_003183444.1 anti-repressor SinI family protein Regulator

Sequence

Protein


Download         Length: 123 a.a.        Molecular weight: 14179.31 Da        Isoelectric Point: 10.3094

>NTDB_id=848026 V5G22_RS16120 WP_003183461.1 3160052..3160423(+) (comGF) [Bacillus licheniformis strain CP26]
MFVAGTMASIFHLFLSPERNGSDIHPREWTITAEQILKESRNSIDIRSAGDHQSLAMTNRQGDTVRYEQYQTVIRKRVNG
KGHVPLLQHVKKMRFMIENHLLILEATSLSGKSYRTSIPLYHM

Nucleotide


Download         Length: 372 bp        

>NTDB_id=848026 V5G22_RS16120 WP_003183461.1 3160052..3160423(+) (comGF) [Bacillus licheniformis strain CP26]
ATGTTCGTTGCAGGTACGATGGCCTCGATATTTCATCTGTTTTTATCCCCGGAAAGAAACGGTTCGGATATTCACCCCCG
TGAATGGACGATTACTGCCGAGCAAATATTGAAGGAGTCTAGGAATTCGATTGACATAAGAAGTGCCGGTGATCATCAGT
CACTAGCGATGACAAACCGCCAAGGTGACACCGTTCGCTATGAGCAATATCAGACAGTTATTCGAAAAAGGGTCAATGGA
AAAGGTCATGTGCCTCTATTACAGCATGTCAAAAAAATGAGGTTTATGATTGAAAATCACCTGCTGATCCTTGAAGCGAC
AAGTCTAAGCGGCAAATCATACCGCACGTCTATTCCGCTCTATCATATGTAA

Domains

Predicted by InterProScan.

Putative Competence protein ComGF (ComGF)

(19-114)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

38.843

98.374

0.382