Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   QRE62_RS22890 Genome accession   NZ_CP128149
Coordinates   3781065..3781844 (-) Length   259 a.a.
NCBI ID   WP_002014541.1    Uniprot ID   -
Organism   Bacillus mycoides strain SIN3.2     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3750570..3807813 3781065..3781844 within 0


Gene organization within MGE regions


Location: 3750570..3807813
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QRE62_RS22750 (QRE62_22745) - 3750612..3751376 (+) 765 WP_002192651.1 hypothetical protein -
  QRE62_RS22755 (QRE62_22750) - 3751520..3753067 (+) 1548 WP_286126128.1 recombinase family protein -
  QRE62_RS22760 (QRE62_22755) dpaB 3753100..3753525 (-) 426 Protein_3708 dipicolinate synthase subunit B -
  QRE62_RS22765 (QRE62_22760) dpaA 3753522..3754424 (-) 903 WP_002088148.1 dipicolinic acid synthetase subunit A -
  QRE62_RS22770 (QRE62_22765) - 3754597..3754845 (-) 249 WP_002014571.1 YlmC/YmxH family sporulation protein -
  QRE62_RS22775 (QRE62_22770) - 3754981..3756222 (-) 1242 WP_002088150.1 pitrilysin family protein -
  QRE62_RS22780 (QRE62_22775) - 3756309..3757208 (-) 900 WP_002033683.1 polysaccharide deacetylase family protein -
  QRE62_RS22785 (QRE62_22780) pnp 3757363..3759516 (-) 2154 WP_286126130.1 polyribonucleotide nucleotidyltransferase -
  QRE62_RS22790 (QRE62_22785) rpsO 3759678..3759947 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  QRE62_RS22795 (QRE62_22790) ribF 3760047..3761018 (-) 972 WP_002128800.1 bifunctional riboflavin kinase/FAD synthetase -
  QRE62_RS22800 (QRE62_22795) truB 3761062..3761985 (-) 924 WP_002033681.1 tRNA pseudouridine(55) synthase TruB -
  QRE62_RS22805 (QRE62_22800) rbfA 3762076..3762432 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  QRE62_RS22810 (QRE62_22805) - 3762448..3762729 (-) 282 WP_002088157.1 DUF503 family protein -
  QRE62_RS22815 (QRE62_22810) infB 3762726..3764792 (-) 2067 WP_002014558.1 translation initiation factor IF-2 -
  QRE62_RS22820 (QRE62_22815) - 3764797..3765108 (-) 312 WP_001286519.1 YlxQ family RNA-binding protein -
  QRE62_RS22825 (QRE62_22820) - 3765109..3765381 (-) 273 WP_002088161.1 YlxR family protein -
  QRE62_RS22830 (QRE62_22825) nusA 3765393..3766499 (-) 1107 WP_002014554.1 transcription termination factor NusA -
  QRE62_RS22835 (QRE62_22830) rimP 3766517..3766987 (-) 471 WP_002088165.1 ribosome maturation factor RimP -
  QRE62_RS22840 (QRE62_22835) - 3767321..3771622 (-) 4302 WP_002033677.1 PolC-type DNA polymerase III -
  QRE62_RS22845 (QRE62_22840) - 3771747..3773447 (-) 1701 WP_078175371.1 proline--tRNA ligase -
  QRE62_RS22850 (QRE62_22845) rseP 3773557..3774813 (-) 1257 WP_002088169.1 RIP metalloprotease RseP -
  QRE62_RS22855 (QRE62_22850) dxr 3774831..3775973 (-) 1143 WP_113709230.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  QRE62_RS22860 (QRE62_22855) cdsA 3775997..3776788 (-) 792 WP_002088171.1 phosphatidate cytidylyltransferase -
  QRE62_RS22865 (QRE62_22860) - 3776806..3777582 (-) 777 WP_002014545.1 isoprenyl transferase -
  QRE62_RS22870 (QRE62_22865) frr 3777668..3778225 (-) 558 WP_000531506.1 ribosome recycling factor -
  QRE62_RS22875 (QRE62_22870) pyrH 3778229..3778951 (-) 723 WP_002014544.1 UMP kinase -
  QRE62_RS22880 (QRE62_22875) tsf 3779018..3779905 (-) 888 WP_002088177.1 translation elongation factor Ts -
  QRE62_RS22885 (QRE62_22880) rpsB 3780009..3780710 (-) 702 WP_002088178.1 30S ribosomal protein S2 -
  QRE62_RS22890 (QRE62_22885) codY 3781065..3781844 (-) 780 WP_002014541.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  QRE62_RS22895 (QRE62_22890) hslU 3781922..3783313 (-) 1392 WP_002014539.1 ATP-dependent protease ATPase subunit HslU -
  QRE62_RS22900 (QRE62_22895) hslV 3783336..3783878 (-) 543 WP_002014538.1 ATP-dependent protease proteolytic subunit HslV -
  QRE62_RS22905 (QRE62_22900) xerC 3783921..3784820 (-) 900 WP_078175468.1 tyrosine recombinase XerC -
  QRE62_RS22910 (QRE62_22905) trmFO 3784892..3786196 (-) 1305 WP_002014534.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  QRE62_RS22915 (QRE62_22910) topA 3786245..3788323 (-) 2079 WP_002088184.1 type I DNA topoisomerase -
  QRE62_RS22920 (QRE62_22915) dprA 3788468..3789337 (-) 870 WP_002014531.1 DNA-processing protein DprA -
  QRE62_RS22925 (QRE62_22920) sucD 3789426..3790328 (-) 903 WP_000115186.1 succinate--CoA ligase subunit alpha -
  QRE62_RS22930 (QRE62_22925) sucC 3790348..3791508 (-) 1161 WP_002014529.1 ADP-forming succinate--CoA ligase subunit beta -
  QRE62_RS22935 (QRE62_22930) - 3791702..3792475 (-) 774 WP_002014527.1 ribonuclease HII -
  QRE62_RS22940 (QRE62_22935) ylqF 3792531..3793421 (-) 891 WP_002014526.1 ribosome biogenesis GTPase YlqF -
  QRE62_RS22945 (QRE62_22940) lepB 3793442..3793993 (-) 552 WP_002066791.1 signal peptidase I -
  QRE62_RS22950 (QRE62_22945) rplS 3794094..3794438 (-) 345 WP_002014524.1 50S ribosomal protein L19 -
  QRE62_RS22955 (QRE62_22950) trmD 3794585..3795319 (-) 735 WP_002014522.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  QRE62_RS22960 (QRE62_22955) rimM 3795319..3795834 (-) 516 WP_002014521.1 ribosome maturation factor RimM -
  QRE62_RS22965 (QRE62_22960) - 3795956..3796183 (-) 228 WP_002088196.1 KH domain-containing protein -
  QRE62_RS22970 (QRE62_22965) rpsP 3796198..3796470 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  QRE62_RS22975 (QRE62_22970) ffh 3796571..3797920 (-) 1350 WP_002014519.1 signal recognition particle protein -
  QRE62_RS22980 (QRE62_22975) - 3797933..3798265 (-) 333 WP_000891061.1 putative DNA-binding protein -
  QRE62_RS22985 (QRE62_22980) ftsY 3798398..3799387 (-) 990 WP_002088200.1 signal recognition particle-docking protein FtsY -
  QRE62_RS22990 (QRE62_22985) smc 3799402..3802971 (-) 3570 WP_002014517.1 chromosome segregation protein SMC -
  QRE62_RS22995 (QRE62_22990) rncS 3803120..3803857 (-) 738 WP_002033792.1 ribonuclease III -
  QRE62_RS23000 (QRE62_22995) acpP 3803916..3804149 (-) 234 WP_002014515.1 acyl carrier protein -
  QRE62_RS23005 (QRE62_23000) fabG 3804219..3804959 (-) 741 WP_286126132.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  QRE62_RS23010 (QRE62_23005) fabD 3804959..3805903 (-) 945 WP_002190506.1 ACP S-malonyltransferase -
  QRE62_RS23015 (QRE62_23010) plsX 3805918..3806910 (-) 993 WP_002128828.1 phosphate acyltransferase PlsX -
  QRE62_RS23020 (QRE62_23015) fapR 3806907..3807500 (-) 594 WP_000747354.1 transcription factor FapR -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28774.99 Da        Isoelectric Point: 4.7251

>NTDB_id=846251 QRE62_RS22890 WP_002014541.1 3781065..3781844(-) (codY) [Bacillus mycoides strain SIN3.2]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKHMLAERQFPEEYTQSLF
NVTETSSNLGVDSDYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=846251 QRE62_RS22890 WP_002014541.1 3781065..3781844(-) (codY) [Bacillus mycoides strain SIN3.2]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAGAT
GTCTGACACAATGTGTGAAGTAATTGAAGCGAACGTGTTCGTTGTAAGTCGTCGCGGTAAATTATTAGGATATGCGATTC
ACCAACAAATCGAAAACGAACGTATGAAGCACATGCTTGCAGAGCGTCAATTCCCAGAAGAGTATACGCAAAGTTTATTC
AATGTTACAGAAACATCTTCAAATTTAGGTGTGGATAGTGACTACACAGCATTCCCAGTAGAAAATAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACACTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGACGATGATTTAATTCTTGCTGAATACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCACGTAGTAAAGCTGTTGTTCAAATGGCGATTAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
CGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GTTCGGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAGGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY helix-turn-helix domain (HTH_CodY)

(198-255)

CodY GAF-like domain (CodY)

(2-178)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.275

98.456

0.456