Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   VKP36_RS00670 Genome accession   NZ_CP142357
Coordinates   104478..104762 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain AW-534     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99478..109762
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VKP36_RS00645 (VKP36_00645) - 101424..101789 (+) 366 WP_002986560.1 DUF1033 family protein -
  VKP36_RS00650 (VKP36_00650) comGA 101882..102820 (+) 939 WP_129304381.1 competence type IV pilus ATPase ComGA Machinery gene
  VKP36_RS00655 (VKP36_00655) comGB 102756..103790 (+) 1035 WP_227868552.1 competence type IV pilus assembly protein ComGB Machinery gene
  VKP36_RS00660 (VKP36_00660) comGC 103792..104118 (+) 327 WP_011528161.1 competence type IV pilus major pilin ComGC Machinery gene
  VKP36_RS00665 (VKP36_00665) comGD 104093..104521 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  VKP36_RS00670 (VKP36_00670) comGE 104478..104762 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  VKP36_RS00675 (VKP36_00675) comGF 104755..105189 (+) 435 WP_326624919.1 competence type IV pilus minor pilin ComGF Machinery gene
  VKP36_RS00680 (VKP36_00680) comGG 105173..105499 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  VKP36_RS00685 (VKP36_00685) comGH 105597..106550 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  VKP36_RS00690 (VKP36_00690) - 106609..107805 (+) 1197 WP_030126459.1 acetate kinase -
  VKP36_RS00695 (VKP36_00695) - 107991..108299 (+) 309 WP_030126458.1 hypothetical protein -
  VKP36_RS00700 (VKP36_00700) proC 108382..109152 (-) 771 WP_002992745.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=840756 VKP36_RS00670 WP_002987779.1 104478..104762(+) (comGE) [Streptococcus pyogenes strain AW-534]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=840756 VKP36_RS00670 WP_002987779.1 104478..104762(+) (comGE) [Streptococcus pyogenes strain AW-534]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383