Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   VKP54_RS00780 Genome accession   NZ_CP142356
Coordinates   118131..118415 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain CT95-157     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 113131..123415
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VKP54_RS00755 (VKP54_00755) - 115077..115442 (+) 366 WP_002986560.1 DUF1033 family protein -
  VKP54_RS00760 (VKP54_00760) comGA 115535..116473 (+) 939 WP_023612548.1 competence type IV pilus ATPase ComGA Machinery gene
  VKP54_RS00765 (VKP54_00765) comGB 116409..117443 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  VKP54_RS00770 (VKP54_00770) comGC 117445..117771 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  VKP54_RS00775 (VKP54_00775) comGD 117746..118174 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  VKP54_RS00780 (VKP54_00780) comGE 118131..118415 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  VKP54_RS00785 (VKP54_00785) comGF 118408..118842 (+) 435 WP_111711329.1 competence type IV pilus minor pilin ComGF Machinery gene
  VKP54_RS00790 (VKP54_00790) comGG 118826..119152 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  VKP54_RS00795 (VKP54_00795) comGH 119250..120203 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  VKP54_RS00800 (VKP54_00800) - 120262..121458 (+) 1197 WP_111711330.1 acetate kinase -
  VKP54_RS00805 (VKP54_00805) - 121645..121953 (+) 309 WP_011284425.1 hypothetical protein -
  VKP54_RS00810 (VKP54_00810) proC 122036..122806 (-) 771 WP_011284426.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=840663 VKP54_RS00780 WP_011284422.1 118131..118415(+) (comGE) [Streptococcus pyogenes strain CT95-157]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=840663 VKP54_RS00780 WP_011284422.1 118131..118415(+) (comGE) [Streptococcus pyogenes strain CT95-157]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGTAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383