Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   VKP39_RS00670 Genome accession   NZ_CP142353
Coordinates   104735..105019 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain D641     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99735..110019
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VKP39_RS00645 (VKP39_00645) - 101681..102046 (+) 366 WP_002986560.1 DUF1033 family protein -
  VKP39_RS00650 (VKP39_00650) comGA 102139..103077 (+) 939 WP_002993471.1 competence type IV pilus ATPase ComGA Machinery gene
  VKP39_RS00655 (VKP39_00655) comGB 103013..104047 (+) 1035 WP_225793059.1 competence type IV pilus assembly protein ComGB Machinery gene
  VKP39_RS00660 (VKP39_00660) comGC 104049..104375 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  VKP39_RS00665 (VKP39_00665) comGD 104350..104778 (+) 429 WP_023605232.1 competence type IV pilus minor pilin ComGD Machinery gene
  VKP39_RS00670 (VKP39_00670) comGE 104735..105019 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  VKP39_RS00675 (VKP39_00675) comGF 105012..105446 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  VKP39_RS00680 (VKP39_00680) comGG 105430..105756 (+) 327 WP_002992739.1 competence type IV pilus minor pilin ComGG -
  VKP39_RS00685 (VKP39_00685) comGH 105854..106807 (+) 954 WP_002987790.1 class I SAM-dependent methyltransferase Machinery gene
  VKP39_RS00690 (VKP39_00690) - 106866..108062 (+) 1197 WP_109821056.1 acetate kinase -
  VKP39_RS00695 (VKP39_00695) - 108249..108557 (+) 309 WP_032467031.1 hypothetical protein -
  VKP39_RS00700 (VKP39_00700) proC 108640..109410 (-) 771 WP_002992745.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=840376 VKP39_RS00670 WP_011284422.1 104735..105019(+) (comGE) [Streptococcus pyogenes strain D641]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=840376 VKP39_RS00670 WP_011284422.1 104735..105019(+) (comGE) [Streptococcus pyogenes strain D641]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTTGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383