Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   VKP55_RS00915 Genome accession   NZ_CP142351
Coordinates   144427..144711 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain SS1366     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 139427..149711
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VKP55_RS00890 (VKP55_00890) - 141373..141738 (+) 366 WP_002986560.1 DUF1033 family protein -
  VKP55_RS00895 (VKP55_00895) comGA 141831..142769 (+) 939 WP_326674278.1 competence type IV pilus ATPase ComGA Machinery gene
  VKP55_RS00900 (VKP55_00900) comGB 142705..143739 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  VKP55_RS00905 (VKP55_00905) comGC 143741..144067 (+) 327 WP_326674280.1 competence type IV pilus major pilin ComGC Machinery gene
  VKP55_RS00910 (VKP55_00910) comGD 144042..144470 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  VKP55_RS00915 (VKP55_00915) comGE 144427..144711 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  VKP55_RS00920 (VKP55_00920) comGF 144704..145138 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  VKP55_RS00925 (VKP55_00925) comGG 145122..145448 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  VKP55_RS00930 (VKP55_00930) comGH 145546..146499 (+) 954 WP_326674282.1 class I SAM-dependent methyltransferase Machinery gene
  VKP55_RS00935 (VKP55_00935) - 146558..147754 (+) 1197 WP_326674284.1 acetate kinase -
  VKP55_RS00940 (VKP55_00940) - 147940..148248 (+) 309 WP_326674286.1 hypothetical protein -
  VKP55_RS00945 (VKP55_00945) proC 148331..149101 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=840184 VKP55_RS00915 WP_002987779.1 144427..144711(+) (comGE) [Streptococcus pyogenes strain SS1366]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=840184 VKP55_RS00915 WP_002987779.1 144427..144711(+) (comGE) [Streptococcus pyogenes strain SS1366]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTGAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383