Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   VKP35_RS00795 Genome accession   NZ_CP142349
Coordinates   121509..121793 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain 11RS100     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 116509..126793
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VKP35_RS00770 (VKP35_00770) - 118455..118820 (+) 366 WP_002986560.1 DUF1033 family protein -
  VKP35_RS00775 (VKP35_00775) comGA 118913..119851 (+) 939 WP_009880361.1 competence type IV pilus ATPase ComGA Machinery gene
  VKP35_RS00780 (VKP35_00780) comGB 119787..120821 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  VKP35_RS00785 (VKP35_00785) comGC 120823..121149 (+) 327 WP_111713112.1 competence type IV pilus major pilin ComGC Machinery gene
  VKP35_RS00790 (VKP35_00790) comGD 121124..121552 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  VKP35_RS00795 (VKP35_00795) comGE 121509..121793 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  VKP35_RS00800 (VKP35_00800) comGF 121786..122220 (+) 435 WP_002986542.1 competence type IV pilus minor pilin ComGF Machinery gene
  VKP35_RS00805 (VKP35_00805) comGG 122204..122530 (+) 327 WP_002986539.1 competence type IV pilus minor pilin ComGG -
  VKP35_RS00810 (VKP35_00810) comGH 122628..123581 (+) 954 WP_032467307.1 class I SAM-dependent methyltransferase Machinery gene
  VKP35_RS00815 (VKP35_00815) - 123640..124836 (+) 1197 WP_002986533.1 acetate kinase -
  VKP35_RS00820 (VKP35_00820) - 125023..125331 (+) 309 WP_011017251.1 hypothetical protein -
  VKP35_RS00825 (VKP35_00825) proC 125414..126184 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=839997 VKP35_RS00795 WP_002987779.1 121509..121793(+) (comGE) [Streptococcus pyogenes strain 11RS100]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=839997 VKP35_RS00795 WP_002987779.1 121509..121793(+) (comGE) [Streptococcus pyogenes strain 11RS100]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAT
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383