Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   QPL84_RS18740 Genome accession   NZ_CP126525
Coordinates   3684831..3685610 (-) Length   259 a.a.
NCBI ID   WP_000421291.1    Uniprot ID   A0A1V6LJD3
Organism   Bacillus toyonensis strain Puebla_S2     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3659541..3721349 3684831..3685610 within 0


Gene organization within MGE regions


Location: 3659541..3721349
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QPL84_RS18630 (QPL84_18630) - 3660111..3661010 (-) 900 WP_000868234.1 polysaccharide deacetylase family protein -
  QPL84_RS18635 (QPL84_18635) pnp 3661162..3663300 (-) 2139 WP_000076735.1 polyribonucleotide nucleotidyltransferase -
  QPL84_RS18640 (QPL84_18640) rpsO 3663461..3663730 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  QPL84_RS18645 (QPL84_18645) ribF 3663831..3664802 (-) 972 WP_000766714.1 bifunctional riboflavin kinase/FAD synthetase -
  QPL84_RS18650 (QPL84_18650) truB 3664846..3665769 (-) 924 WP_000399334.1 tRNA pseudouridine(55) synthase TruB -
  QPL84_RS18655 (QPL84_18655) rbfA 3665855..3666211 (-) 357 WP_000776439.1 30S ribosome-binding factor RbfA -
  QPL84_RS18660 (QPL84_18660) - 3666227..3666508 (-) 282 WP_000582364.1 DUF503 family protein -
  QPL84_RS18665 (QPL84_18665) infB 3666505..3668565 (-) 2061 WP_000036352.1 translation initiation factor IF-2 -
  QPL84_RS18670 (QPL84_18670) - 3668570..3668881 (-) 312 WP_001286525.1 YlxQ family RNA-binding protein -
  QPL84_RS18675 (QPL84_18675) - 3668882..3669154 (-) 273 WP_000071127.1 YlxR family protein -
  QPL84_RS18680 (QPL84_18680) nusA 3669166..3670272 (-) 1107 WP_000102596.1 transcription termination factor NusA -
  QPL84_RS18685 (QPL84_18685) rimP 3670290..3670760 (-) 471 WP_000359095.1 ribosome maturation factor RimP -
  QPL84_RS18690 (QPL84_18690) - 3671094..3675395 (-) 4302 WP_000060011.1 PolC-type DNA polymerase III -
  QPL84_RS18695 (QPL84_18695) - 3675520..3677220 (-) 1701 WP_000814325.1 proline--tRNA ligase -
  QPL84_RS18700 (QPL84_18700) rseP 3677330..3678586 (-) 1257 WP_001090232.1 RIP metalloprotease RseP -
  QPL84_RS18705 (QPL84_18705) dxr 3678604..3679746 (-) 1143 WP_000790354.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  QPL84_RS18710 (QPL84_18710) cdsA 3679770..3680561 (-) 792 WP_000813595.1 phosphatidate cytidylyltransferase -
  QPL84_RS18715 (QPL84_18715) uppS 3680579..3681355 (-) 777 WP_000971308.1 isoprenyl transferase -
  QPL84_RS18720 (QPL84_18720) frr 3681441..3681998 (-) 558 WP_000531505.1 ribosome recycling factor -
  QPL84_RS18725 (QPL84_18725) pyrH 3682001..3682723 (-) 723 WP_000042662.1 UMP kinase -
  QPL84_RS18730 (QPL84_18730) tsf 3682790..3683677 (-) 888 WP_001018579.1 translation elongation factor Ts -
  QPL84_RS18735 (QPL84_18735) rpsB 3683781..3684482 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  QPL84_RS18740 (QPL84_18740) codY 3684831..3685610 (-) 780 WP_000421291.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  QPL84_RS18745 (QPL84_18745) hslU 3685688..3687079 (-) 1392 WP_000550076.1 ATP-dependent protease ATPase subunit HslU -
  QPL84_RS18750 (QPL84_18750) hslV 3687102..3687644 (-) 543 WP_000526274.1 ATP-dependent protease proteolytic subunit HslV -
  QPL84_RS18755 (QPL84_18755) xerC 3687687..3688586 (-) 900 WP_001101240.1 tyrosine recombinase XerC -
  QPL84_RS18760 (QPL84_18760) trmFO 3688652..3689956 (-) 1305 WP_000212000.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  QPL84_RS18765 (QPL84_18765) topA 3690005..3692083 (-) 2079 WP_001286961.1 type I DNA topoisomerase -
  QPL84_RS18770 (QPL84_18770) dprA 3692228..3693097 (-) 870 WP_000818051.1 DNA-processing protein DprA -
  QPL84_RS18775 (QPL84_18775) sucD 3693186..3694088 (-) 903 WP_000115185.1 succinate--CoA ligase subunit alpha -
  QPL84_RS18780 (QPL84_18780) sucC 3694108..3695268 (-) 1161 WP_001020779.1 ADP-forming succinate--CoA ligase subunit beta -
  QPL84_RS18785 (QPL84_18785) - 3695463..3696236 (-) 774 WP_001171132.1 ribonuclease HII -
  QPL84_RS18790 (QPL84_18790) ylqF 3696293..3697183 (-) 891 WP_000236689.1 ribosome biogenesis GTPase YlqF -
  QPL84_RS18795 (QPL84_18795) lepB 3697204..3697755 (-) 552 WP_185777787.1 signal peptidase I -
  QPL84_RS18800 (QPL84_18800) rplS 3697857..3698201 (-) 345 WP_001186517.1 50S ribosomal protein L19 -
  QPL84_RS18805 (QPL84_18805) trmD 3698348..3699082 (-) 735 WP_000686907.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  QPL84_RS18810 (QPL84_18810) rimM 3699082..3699597 (-) 516 WP_000170280.1 ribosome maturation factor RimM -
  QPL84_RS18815 (QPL84_18815) - 3699719..3699946 (-) 228 WP_000737399.1 KH domain-containing protein -
  QPL84_RS18820 (QPL84_18820) rpsP 3699961..3700233 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  QPL84_RS18825 (QPL84_18825) ffh 3700335..3701684 (-) 1350 WP_000863463.1 signal recognition particle protein -
  QPL84_RS18830 (QPL84_18830) - 3701697..3702029 (-) 333 WP_000891061.1 putative DNA-binding protein -
  QPL84_RS18835 (QPL84_18835) ftsY 3702163..3703152 (-) 990 WP_000007643.1 signal recognition particle-docking protein FtsY -
  QPL84_RS18840 (QPL84_18840) smc 3703167..3706736 (-) 3570 WP_000479010.1 chromosome segregation protein SMC -
  QPL84_RS18845 (QPL84_18845) rncS 3706883..3707620 (-) 738 WP_001146877.1 ribonuclease III -
  QPL84_RS18850 (QPL84_18850) acpP 3707680..3707913 (-) 234 WP_000786062.1 acyl carrier protein -
  QPL84_RS18855 (QPL84_18855) fabG 3707983..3708723 (-) 741 WP_000911780.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  QPL84_RS18860 (QPL84_18860) fabD 3708723..3709667 (-) 945 WP_061529569.1 ACP S-malonyltransferase -
  QPL84_RS18865 (QPL84_18865) plsX 3709682..3710674 (-) 993 WP_000684090.1 phosphate acyltransferase PlsX -
  QPL84_RS18870 (QPL84_18870) fapR 3710671..3711264 (-) 594 WP_284558129.1 transcription factor FapR -
  QPL84_RS18875 (QPL84_18875) recG 3711353..3713401 (-) 2049 WP_098684472.1 ATP-dependent DNA helicase RecG -
  QPL84_RS18880 (QPL84_18880) - 3713691..3715367 (-) 1677 WP_000027119.1 DAK2 domain-containing protein -
  QPL84_RS18885 (QPL84_18885) - 3715390..3715752 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  QPL84_RS18890 (QPL84_18890) rpmB 3716129..3716317 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  QPL84_RS18895 (QPL84_18895) spoVM 3716391..3716471 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  QPL84_RS18900 (QPL84_18900) - 3716538..3717218 (-) 681 WP_002039429.1 thiamine diphosphokinase -
  QPL84_RS18905 (QPL84_18905) rpe 3717319..3717963 (-) 645 WP_097837482.1 ribulose-phosphate 3-epimerase -
  QPL84_RS18910 (QPL84_18910) rsgA 3717966..3718847 (-) 882 WP_001113944.1 ribosome small subunit-dependent GTPase A -
  QPL84_RS18915 (QPL84_18915) prkC 3719117..3721090 (-) 1974 WP_000904738.1 serine/threonine protein kinase PrkC -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28788.03 Da        Isoelectric Point: 4.7947

>NTDB_id=838424 QPL84_RS18740 WP_000421291.1 3684831..3685610(-) (codY) [Bacillus toyonensis strain Puebla_S2]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NVTETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=838424 QPL84_RS18740 WP_000421291.1 3684831..3685610(-) (codY) [Bacillus toyonensis strain Puebla_S2]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGATACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAACGAGCGTATGAAACAAATGCTTGCAGAGCGTCAATTCCCAGAAGAATATACGCAAAGCTTATTC
AATGTAACGGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTGTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAATACAGTTCAACTGTAGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCACGTAGTAAAGCTGTTGTTCAAATGGCGATTAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCACATTTTCGAAGAGTTAAACGGAACAGAAGGTCTACTTGTTGCAAGTAAAATTGCTGATCGTGTAGGAATCACTC
GTTCTGTGATTGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTAATCGAGTCTCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTTTTACATGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A1V6LJD3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.853

100

0.819

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.275

98.456

0.456