Detailed information NTG0836703

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: QLQ22_RS17705
• Genome accession: NZ_CP126116
• Coordinates: 3566272..3566580 (-)
• Length: 102 a.a.
• NCBI ID: WP_223436678.1
• Uniprot ID: -
• Organism: Metabacillus sp. CT-WN-B3
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3561272..3571580

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QLQ22_RS17645 (QLQ22_17645)	-	3561442..3561777 (+)	336	WP_223436659.1	helix-turn-helix domain-containing protein	-
QLQ22_RS17650 (QLQ22_17650)	-	3561877..3562077 (-)	201	WP_223436660.1	hypothetical protein	-
QLQ22_RS17655 (QLQ22_17655)	-	3562094..3562393 (-)	300	WP_252207182.1	DUF5658 family protein	-
QLQ22_RS17660 (QLQ22_17660)	-	3562719..3562946 (-)	228	WP_252207183.1	hypothetical protein	-
QLQ22_RS17665 (QLQ22_17665)	-	3563022..3563354 (+)	333	WP_223436665.1	DUF3889 domain-containing protein	-
QLQ22_RS17670 (QLQ22_17670)	-	3563519..3563743 (-)	225	Protein_3447	tyrosine-protein phosphatase	-
QLQ22_RS17675 (QLQ22_17675)	-	3563933..3564112 (-)	180	WP_223436668.1	YqzE family protein	-
QLQ22_RS17680 (QLQ22_17680)	-	3564137..3564655 (-)	519	WP_284015279.1	shikimate kinase	-
QLQ22_RS17685 (QLQ22_17685)	comGG	3564731..3565105 (-)	375	WP_223436671.1	competence type IV pilus minor pilin ComGG	-
QLQ22_RS17690 (QLQ22_17690)	comGF	3565102..3565599 (-)	498	WP_284015280.1	competence type IV pilus minor pilin ComGF	-
QLQ22_RS17695 (QLQ22_17695)	comGE	3565526..3565855 (-)	330	WP_223436674.1	competence type IV pilus minor pilin ComGE	-
QLQ22_RS17700 (QLQ22_17700)	comGD	3565842..3566294 (-)	453	WP_223436676.1	competence type IV pilus minor pilin ComGD	-
QLQ22_RS17705 (QLQ22_17705)	comGC	3566272..3566580 (-)	309	WP_223436678.1	competence type IV pilus major pilin ComGC	Machinery gene
QLQ22_RS17710 (QLQ22_17710)	comGB	3566606..3567640 (-)	1035	WP_252207187.1	competence type IV pilus assembly protein ComGB	-
QLQ22_RS17715 (QLQ22_17715)	comGA	3567630..3568697 (-)	1068	WP_223436682.1	competence type IV pilus ATPase ComGA	Machinery gene
QLQ22_RS17725 (QLQ22_17725)	-	3569009..3569257 (-)	249	WP_223436684.1	hypothetical protein	-
QLQ22_RS17730 (QLQ22_17730)	-	3569445..3569825 (-)	381	WP_223436686.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
QLQ22_RS17735 (QLQ22_17735)	-	3570096..3570341 (+)	246	WP_070876617.1	DUF2626 domain-containing protein	-
QLQ22_RS17740 (QLQ22_17740)	-	3570384..3571475 (-)	1092	WP_284015281.1	SAM-dependent methyltransferase	-

Sequence

Protein

• Length: 102 a.a.
• Molecular weight: 11249.05 Da
• Isoelectric Point: 4.6749

>NTDB_id=836703 QLQ22_RS17705 WP_223436678.1 3566272..3566580(-) (comGC) [Metabacillus sp. CT-WN-B3]
MVKNEKGFTLIEMLIVLLVISVLLLITIPNITKHHSNIQAKGCEGLKNTVQAQSTAYQIEQKAVPTIEDLKTEKYIEESP
VCPNGTELIIDGDGKVAEKTEE

Nucleotide

• Length: 309 bp

>NTDB_id=836703 QLQ22_RS17705 WP_223436678.1 3566272..3566580(-) (comGC) [Metabacillus sp. CT-WN-B3]
ATGGTTAAAAATGAGAAAGGTTTTACTTTAATAGAAATGCTGATTGTATTGCTTGTGATTTCTGTCCTGCTTTTGATTAC
CATTCCAAACATTACGAAGCATCACTCGAATATTCAGGCAAAAGGATGCGAAGGGCTGAAAAATACAGTACAGGCCCAGT
CAACTGCCTATCAAATTGAACAAAAAGCAGTACCCACTATAGAGGATCTTAAGACTGAGAAATATATTGAGGAATCCCCT
GTTTGCCCGAATGGAACGGAGCTGATTATTGATGGTGATGGCAAGGTTGCTGAAAAGACAGAAGAATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (3-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Bacillus subtilis subsp. subtilis str. 168	58.889	88.235	0.52
comGC	Staphylococcus aureus MW2	40.404	97.059	0.392
comGC	Staphylococcus aureus N315	40.404	97.059	0.392