Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   QNK02_RS12595 Genome accession   NZ_CP126083
Coordinates   2445988..2446371 (-) Length   127 a.a.
NCBI ID   WP_041850015.1    Uniprot ID   -
Organism   Bacillus subtilis strain C1_9     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2440988..2451371
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNK02_RS12555 (QNK02_12555) sinI 2441922..2442095 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QNK02_RS12560 (QNK02_12560) sinR 2442129..2442464 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QNK02_RS12565 (QNK02_12565) tasA 2442557..2443342 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  QNK02_RS12570 (QNK02_12570) sipW 2443406..2443978 (-) 573 WP_003246088.1 signal peptidase I SipW -
  QNK02_RS12575 (QNK02_12575) tapA 2443962..2444723 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  QNK02_RS12580 (QNK02_12580) yqzG 2444995..2445321 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QNK02_RS12585 (QNK02_12585) spoIIT 2445363..2445542 (-) 180 WP_003230176.1 YqzE family protein -
  QNK02_RS12590 (QNK02_12590) comGG 2445613..2445987 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  QNK02_RS12595 (QNK02_12595) comGF 2445988..2446371 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  QNK02_RS12600 (QNK02_12600) comGE 2446397..2446744 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  QNK02_RS12605 (QNK02_12605) comGD 2446728..2447159 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  QNK02_RS12610 (QNK02_12610) comGC 2447149..2447445 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  QNK02_RS12615 (QNK02_12615) comGB 2447459..2448496 (-) 1038 WP_041850016.1 comG operon protein ComGB Machinery gene
  QNK02_RS12620 (QNK02_12620) comGA 2448483..2449553 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  QNK02_RS12625 (QNK02_12625) corA 2449964..2450917 (-) 954 WP_029317911.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14250.41 Da        Isoelectric Point: 6.4838

>NTDB_id=834914 QNK02_RS12595 WP_041850015.1 2445988..2446371(-) (comGF) [Bacillus subtilis strain C1_9]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHIAAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=834914 QNK02_RS12595 WP_041850015.1 2445988..2446371(-) (comGF) [Bacillus subtilis strain C1_9]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984