Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   QM226_RS19415 Genome accession   NZ_CP125992
Coordinates   3793230..3794009 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus cereus strain FFI_gr_36     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3758908..3832834 3793230..3794009 within 0


Gene organization within MGE regions


Location: 3758908..3832834
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QM226_RS19265 (QM226_003866) - 3759251..3760921 (-) 1671 WP_000823085.1 ribonuclease J -
  QM226_RS19270 (QM226_003867) dapA 3761687..3762565 (-) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  QM226_RS19275 (QM226_003868) dapG 3762577..3763809 (-) 1233 WP_000692470.1 aspartate kinase -
  QM226_RS19280 (QM226_003869) asd 3763833..3764879 (-) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  QM226_RS19285 (QM226_003870) dpaB 3765030..3765629 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  QM226_RS19290 (QM226_003871) dpaA 3765626..3766528 (-) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  QM226_RS19295 (QM226_003872) - 3766803..3767054 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  QM226_RS19300 (QM226_003873) - 3767181..3768422 (-) 1242 WP_283729293.1 pitrilysin family protein -
  QM226_RS19305 (QM226_003874) - 3768509..3769408 (-) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  QM226_RS19310 (QM226_003875) pnp 3769560..3771698 (-) 2139 WP_000076750.1 polyribonucleotide nucleotidyltransferase -
  QM226_RS19315 (QM226_003876) rpsO 3771859..3772128 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  QM226_RS19320 (QM226_003877) ribF 3772229..3773200 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  QM226_RS19325 (QM226_003878) truB 3773244..3774167 (-) 924 WP_000399357.1 tRNA pseudouridine(55) synthase TruB -
  QM226_RS19330 (QM226_003879) rbfA 3774254..3774610 (-) 357 WP_000776441.1 30S ribosome-binding factor RbfA -
  QM226_RS19335 (QM226_003880) - 3774626..3774907 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  QM226_RS19340 (QM226_003881) infB 3774904..3776964 (-) 2061 WP_000036341.1 translation initiation factor IF-2 -
  QM226_RS19345 (QM226_003882) - 3776969..3777280 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  QM226_RS19350 (QM226_003883) rnpM 3777281..3777553 (-) 273 WP_000071128.1 RNase P modulator RnpM -
  QM226_RS19355 (QM226_003884) nusA 3777565..3778671 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  QM226_RS19360 (QM226_003885) rimP 3778689..3779159 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  QM226_RS19365 (QM226_003886) - 3779492..3783793 (-) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  QM226_RS19370 (QM226_003887) - 3783918..3785618 (-) 1701 WP_000814312.1 proline--tRNA ligase -
  QM226_RS19375 (QM226_003888) rseP 3785728..3786984 (-) 1257 WP_001090229.1 RIP metalloprotease RseP -
  QM226_RS19380 (QM226_003889) dxr 3787001..3788143 (-) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  QM226_RS19385 (QM226_003890) cdsA 3788167..3788958 (-) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  QM226_RS19390 (QM226_003891) uppS 3788976..3789752 (-) 777 WP_000971301.1 isoprenyl transferase -
  QM226_RS19395 (QM226_003892) frr 3789838..3790395 (-) 558 WP_000531503.1 ribosome recycling factor -
  QM226_RS19400 (QM226_003893) pyrH 3790398..3791120 (-) 723 WP_000042663.1 UMP kinase -
  QM226_RS19405 (QM226_003894) tsf 3791187..3792074 (-) 888 WP_001018581.1 translation elongation factor Ts -
  QM226_RS19410 (QM226_003895) rpsB 3792178..3792879 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  QM226_RS19415 (QM226_003896) codY 3793230..3794009 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  QM226_RS19420 (QM226_003897) hslU 3794087..3795478 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  QM226_RS19425 (QM226_003898) hslV 3795501..3796043 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  QM226_RS19430 (QM226_003899) xerC 3796086..3796985 (-) 900 WP_001101227.1 tyrosine recombinase XerC -
  QM226_RS19435 (QM226_003900) trmFO 3797051..3798355 (-) 1305 WP_001991958.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  QM226_RS19440 (QM226_003901) topA 3798406..3800484 (-) 2079 WP_001286969.1 type I DNA topoisomerase -
  QM226_RS19445 (QM226_003902) dprA 3800629..3801498 (-) 870 WP_000818036.1 DNA-processing protein DprA -
  QM226_RS19450 (QM226_003903) sucD 3801586..3802488 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  QM226_RS19455 (QM226_003904) sucC 3802509..3803669 (-) 1161 WP_001020785.1 ADP-forming succinate--CoA ligase subunit beta -
  QM226_RS19460 (QM226_003905) rnhB 3803863..3804636 (-) 774 WP_001174714.1 ribonuclease HII -
  QM226_RS19465 (QM226_003906) ylqF 3804688..3805578 (-) 891 WP_000236696.1 ribosome biogenesis GTPase YlqF -
  QM226_RS19470 (QM226_003907) lepB 3805599..3806150 (-) 552 WP_000711857.1 signal peptidase I -
  QM226_RS19475 (QM226_003908) rplS 3806252..3806596 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  QM226_RS19480 (QM226_003909) trmD 3806743..3807477 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  QM226_RS19485 (QM226_003910) rimM 3807477..3807992 (-) 516 WP_000170268.1 ribosome maturation factor RimM -
  QM226_RS19490 (QM226_003911) - 3808113..3808340 (-) 228 WP_000737398.1 KH domain-containing protein -
  QM226_RS19495 (QM226_003912) rpsP 3808355..3808627 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  QM226_RS19500 (QM226_003913) ffh 3808728..3810077 (-) 1350 WP_000863458.1 signal recognition particle protein -
  QM226_RS19505 (QM226_003914) - 3810090..3810422 (-) 333 WP_000891062.1 putative DNA-binding protein -
  QM226_RS19510 (QM226_003915) ftsY 3810556..3811545 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  QM226_RS19515 (QM226_003916) smc 3811561..3815130 (-) 3570 WP_000478986.1 chromosome segregation protein SMC -
  QM226_RS19520 (QM226_003917) rncS 3815277..3816014 (-) 738 WP_001146873.1 ribonuclease III -
  QM226_RS19525 (QM226_003918) acpP 3816073..3816306 (-) 234 WP_000786062.1 acyl carrier protein -
  QM226_RS19530 (QM226_003919) fabG 3816376..3817116 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  QM226_RS19535 (QM226_003920) fabD 3817116..3818060 (-) 945 WP_000516948.1 ACP S-malonyltransferase -
  QM226_RS19540 (QM226_003921) plsX 3818075..3819067 (-) 993 WP_000684108.1 phosphate acyltransferase PlsX -
  QM226_RS19545 (QM226_003922) fapR 3819064..3819657 (-) 594 WP_000747352.1 transcription factor FapR -
  QM226_RS19550 (QM226_003923) recG 3819746..3821794 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  QM226_RS19555 (QM226_003924) - 3822084..3823760 (-) 1677 WP_000027136.1 DAK2 domain-containing protein -
  QM226_RS19560 (QM226_003925) - 3823783..3824145 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  QM226_RS19565 (QM226_003926) rpmB 3824524..3824712 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  QM226_RS19570 (QM226_003927) spoVM 3824786..3824866 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  QM226_RS19575 (QM226_003928) - 3824933..3825613 (-) 681 WP_025388434.1 thiamine diphosphokinase -
  QM226_RS19580 (QM226_003929) rpe 3825713..3826357 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  QM226_RS19585 (QM226_003930) rsgA 3826360..3827241 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  QM226_RS19590 (QM226_003931) prkC 3827510..3829483 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  QM226_RS19595 (QM226_003932) - 3829492..3830244 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  QM226_RS19600 (QM226_003933) rlmN 3830249..3831337 (-) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  QM226_RS19605 (QM226_003934) rsmB 3831342..3832676 (-) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=834209 QM226_RS19415 WP_000421288.1 3793230..3794009(-) (codY) [Bacillus cereus strain FFI_gr_36]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=834209 QM226_RS19415 WP_000421288.1 3793230..3794009(-) (codY) [Bacillus cereus strain FFI_gr_36]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459