Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   QLH33_RS11690 Genome accession   NZ_CP125654
Coordinates   2440024..2440338 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain TS5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2435024..2445338
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QLH33_RS11645 (QLH33_11645) sinI 2435705..2435878 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  QLH33_RS11650 (QLH33_11650) sinR 2435912..2436247 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QLH33_RS11655 (QLH33_11655) - 2436295..2437080 (-) 786 WP_032874027.1 TasA family protein -
  QLH33_RS11660 (QLH33_11660) - 2437145..2437729 (-) 585 WP_032874025.1 signal peptidase I -
  QLH33_RS11665 (QLH33_11665) tapA 2437701..2438372 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  QLH33_RS11670 (QLH33_11670) - 2438631..2438960 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  QLH33_RS11675 (QLH33_11675) - 2439001..2439180 (-) 180 WP_022552966.1 YqzE family protein -
  QLH33_RS11680 (QLH33_11680) comGG 2439237..2439614 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  QLH33_RS11685 (QLH33_11685) comGF 2439615..2440115 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  QLH33_RS11690 (QLH33_11690) comGE 2440024..2440338 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  QLH33_RS11695 (QLH33_11695) comGD 2440322..2440759 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  QLH33_RS11700 (QLH33_11700) comGC 2440749..2441057 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  QLH33_RS11705 (QLH33_11705) comGB 2441062..2442099 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  QLH33_RS11710 (QLH33_11710) comGA 2442086..2443156 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  QLH33_RS11715 (QLH33_11715) - 2443353..2444303 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=832072 QLH33_RS11690 WP_032874016.1 2440024..2440338(-) (comGE) [Bacillus velezensis strain TS5]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=832072 QLH33_RS11690 WP_032874016.1 2440024..2440338(-) (comGE) [Bacillus velezensis strain TS5]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481