Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   R6Y88_RS19440 Genome accession   NZ_CP137687
Coordinates   3805563..3805946 (+) Length   127 a.a.
NCBI ID   WP_015384087.1    Uniprot ID   -
Organism   Bacillus subtilis strain YT-4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3800563..3810946
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R6Y88_RS19410 corA 3801018..3801971 (+) 954 WP_015483432.1 magnesium transporter CorA -
  R6Y88_RS19415 comGA 3802381..3803451 (+) 1071 WP_015483431.1 competence protein ComGA Machinery gene
  R6Y88_RS19420 comGB 3803438..3804475 (+) 1038 WP_015483430.1 comG operon protein ComGB Machinery gene
  R6Y88_RS19425 comGC 3804489..3804785 (+) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  R6Y88_RS19430 comGD 3804775..3805206 (+) 432 WP_015384089.1 comG operon protein ComGD Machinery gene
  R6Y88_RS19435 comGE 3805190..3805537 (+) 348 WP_015384088.1 ComG operon protein 5 Machinery gene
  R6Y88_RS19440 comGF 3805563..3805946 (+) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  R6Y88_RS19445 comGG 3805947..3806321 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  R6Y88_RS19450 spoIITA 3806393..3806572 (+) 180 WP_003230176.1 YqzE family protein -
  R6Y88_RS19455 yqzG 3806614..3806940 (-) 327 WP_015384086.1 YqzG/YhdC family protein -
  R6Y88_RS19460 tapA 3807210..3807971 (+) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  R6Y88_RS19465 sipW 3807955..3808527 (+) 573 WP_080030740.1 signal peptidase I SipW -
  R6Y88_RS19470 tasA 3808591..3809376 (+) 786 WP_003230183.1 biofilm matrix protein TasA -
  R6Y88_RS19475 sinR 3809469..3809804 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  R6Y88_RS19480 sinI 3809838..3810011 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14293.34 Da        Isoelectric Point: 5.1404

>NTDB_id=822864 R6Y88_RS19440 WP_015384087.1 3805563..3805946(+) (comGF) [Bacillus subtilis strain YT-4]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEDGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=822864 R6Y88_RS19440 WP_015384087.1 3805563..3805946(+) (comGF) [Bacillus subtilis strain YT-4]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGGATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCACTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984