Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   QAP05_RS06990 Genome accession   NZ_CP122952
Coordinates   1458449..1458562 (-) Length   37 a.a.
NCBI ID   WP_001217870.1    Uniprot ID   -
Organism   Helicobacter pylori strain BS27-1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1453449..1463562
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QAP05_RS06970 (QAP05_06965) - 1454136..1455548 (-) 1413 WP_286491156.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  QAP05_RS06975 (QAP05_06970) comB10 1455618..1456754 (-) 1137 WP_180411350.1 DNA type IV secretion system protein ComB10 Machinery gene
  QAP05_RS06980 (QAP05_06975) comB9 1456747..1457709 (-) 963 WP_286491157.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  QAP05_RS06985 (QAP05_06980) comB8 1457709..1458452 (-) 744 WP_001208392.1 virB8 family protein Machinery gene
  QAP05_RS06990 (QAP05_06985) comB7 1458449..1458562 (-) 114 WP_001217870.1 hypothetical protein Machinery gene
  QAP05_RS06995 (QAP05_06990) comB6 1458578..1459633 (-) 1056 WP_286491158.1 P-type conjugative transfer protein TrbL Machinery gene
  QAP05_RS07000 (QAP05_06995) - 1459642..1460646 (-) 1005 WP_286491159.1 PDZ domain-containing protein -
  QAP05_RS07005 (QAP05_07000) - 1460646..1460948 (-) 303 WP_120956962.1 YbaB/EbfC family nucleoid-associated protein -
  QAP05_RS07010 (QAP05_07005) panD 1460951..1461304 (-) 354 WP_000142250.1 aspartate 1-decarboxylase -
  QAP05_RS07015 (QAP05_07010) - 1461294..1463519 (-) 2226 WP_286491160.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4305.26 Da        Isoelectric Point: 9.3572

>NTDB_id=817407 QAP05_RS06990 WP_001217870.1 1458449..1458562(-) (comB7) [Helicobacter pylori strain BS27-1]
MRIFFVIMGLLLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=817407 QAP05_RS06990 WP_001217870.1 1458449..1458562(-) (comB7) [Helicobacter pylori strain BS27-1]
ATGAGAATTTTTTTTGTTATCATGGGACTTTTGTTATTTGGTTGCACGAGCAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

94.595

100

0.946