Detailed information
Bioinformatically predicted
Overview
| Name | comB2 | Type | Machinery gene |
| Locus tag | QAP07_RS05570 | Genome accession | NZ_CP122946 |
| Coordinates | 1181174..1181458 (+) | Length | 94 a.a. |
| NCBI ID | WP_048945574.1 | Uniprot ID | - |
| Organism | Helicobacter pylori strain BS31 | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1141967..1238595 | 1181174..1181458 | within | 0 |
Gene organization within MGE regions
Location: 1141967..1238595
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QAP07_RS05385 (QAP07_05385) | - | 1142675..1143037 (+) | 363 | WP_000953825.1 | hypothetical protein | - |
| QAP07_RS05390 (QAP07_05390) | - | 1143400..1144413 (-) | 1014 | WP_101003276.1 | LapA family protein | - |
| QAP07_RS05395 (QAP07_05395) | rlmH | 1144423..1144874 (-) | 452 | Protein_1054 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| QAP07_RS05400 (QAP07_05400) | accD | 1144888..1145757 (-) | 870 | WP_000505037.1 | acetyl-CoA carboxylase, carboxyltransferase subunit beta | - |
| QAP07_RS05405 (QAP07_05405) | recO | 1145838..1146452 (+) | 615 | WP_162965200.1 | recombination protein RecO | - |
| QAP07_RS05410 (QAP07_05410) | - | 1146463..1147119 (+) | 657 | WP_286444002.1 | nicotinamide-nucleotide amidohydrolase family protein | - |
| QAP07_RS05415 (QAP07_05415) | - | 1147122..1147688 (-) | 567 | WP_286444005.1 | hypothetical protein | - |
| QAP07_RS05420 (QAP07_05420) | rdxA | 1147753..1148385 (-) | 633 | WP_286444008.1 | oxygen-insensitive NAD(P)H-dependent oxidoreductase RdxA | - |
| QAP07_RS05425 (QAP07_05425) | lgt | 1148396..1149235 (-) | 840 | WP_286444010.1 | prolipoprotein diacylglyceryl transferase | - |
| QAP07_RS05430 (QAP07_05430) | - | 1149245..1149973 (-) | 729 | WP_286444013.1 | RluA family pseudouridine synthase | - |
| QAP07_RS05435 (QAP07_05435) | waaA | 1149985..1151166 (-) | 1182 | WP_286444015.1 | lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase | - |
| QAP07_RS05440 (QAP07_05440) | - | 1151167..1151946 (-) | 780 | WP_286444017.1 | zinc ribbon domain-containing protein | - |
| QAP07_RS05445 (QAP07_05445) | - | 1151956..1152687 (-) | 732 | WP_286444019.1 | Nif3-like dinuclear metal center hexameric protein | - |
| QAP07_RS05450 (QAP07_05450) | glyQ | 1152689..1153585 (-) | 897 | WP_286444021.1 | glycine--tRNA ligase subunit alpha | - |
| QAP07_RS05455 (QAP07_05455) | - | 1153599..1154537 (-) | 939 | WP_000401705.1 | NAD(P)H-dependent glycerol-3-phosphate dehydrogenase | - |
| QAP07_RS05460 (QAP07_05460) | acpP | 1154669..1156122 (-) | 1454 | Protein_1067 | acyl carrier protein | - |
| QAP07_RS05465 (QAP07_05465) | - | 1156173..1157432 (-) | 1260 | WP_286443611.1 | RNA-guided endonuclease TnpB family protein | - |
| QAP07_RS05470 (QAP07_05470) | - | 1157407..1158060 (-) | 654 | WP_286444025.1 | IS607-like element IS607 family transposase | - |
| QAP07_RS05475 (QAP07_05475) | - | 1158121..1158564 (-) | 444 | WP_286444027.1 | dynamin family protein | - |
| QAP07_RS05480 (QAP07_05480) | - | 1158561..1160903 (-) | 2343 | WP_286444029.1 | dynamin family protein | - |
| QAP07_RS05485 (QAP07_05485) | - | 1160905..1162158 (-) | 1254 | WP_286444031.1 | GTPase | - |
| QAP07_RS05490 (QAP07_05490) | - | 1162206..1162493 (-) | 288 | WP_000271456.1 | endoribonuclease VapD | - |
| QAP07_RS05495 (QAP07_05495) | - | 1162563..1162844 (-) | 282 | WP_000880314.1 | DUF3240 family protein | - |
| QAP07_RS05500 (QAP07_05500) | - | 1162855..1165914 (-) | 3060 | WP_286445173.1 | efflux RND transporter permease subunit | - |
| QAP07_RS05505 (QAP07_05505) | - | 1165914..1166963 (-) | 1050 | WP_164997434.1 | efflux RND transporter periplasmic adaptor subunit | - |
| QAP07_RS05510 (QAP07_05510) | - | 1166984..1168279 (-) | 1296 | WP_286444036.1 | TolC family protein | - |
| QAP07_RS05515 (QAP07_05515) | glyS | 1168269..1170374 (-) | 2106 | WP_286444040.1 | glycine--tRNA ligase subunit beta | - |
| QAP07_RS05520 (QAP07_05520) | - | 1170487..1171569 (+) | 1083 | WP_286444042.1 | hypothetical protein | - |
| QAP07_RS05525 (QAP07_05525) | gpmI | 1171582..1173057 (+) | 1476 | WP_286444044.1 | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase | - |
| QAP07_RS05530 (QAP07_05530) | gatC | 1173072..1173353 (+) | 282 | WP_286444046.1 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC | - |
| QAP07_RS05535 (QAP07_05535) | - | 1173430..1174740 (-) | 1311 | WP_286444048.1 | adenosylmethionine--8-amino-7-oxononanoate transaminase | - |
| QAP07_RS05540 (QAP07_05540) | - | 1174870..1176333 (+) | 1464 | WP_286444051.1 | peptidylprolyl isomerase | - |
| QAP07_RS05545 (QAP07_05545) | ftsA | 1176348..1177829 (+) | 1482 | WP_286444054.1 | cell division protein FtsA | - |
| QAP07_RS05550 (QAP07_05550) | ftsZ | 1177958..1179115 (+) | 1158 | WP_000233604.1 | cell division protein FtsZ | - |
| QAP07_RS05555 (QAP07_05555) | - | 1179550..1179739 (-) | 190 | Protein_1086 | hypothetical protein | - |
| QAP07_RS05560 (QAP07_05560) | - | 1179806..1180594 (+) | 789 | WP_286444057.1 | integrase | - |
| QAP07_RS05565 (QAP07_05565) | - | 1180698..1181177 (+) | 480 | WP_000571125.1 | hypothetical protein | - |
| QAP07_RS05570 (QAP07_05570) | comB2 | 1181174..1181458 (+) | 285 | WP_048945574.1 | TrbC/VirB2 family protein | Machinery gene |
| QAP07_RS05575 (QAP07_05575) | comB3 | 1181469..1181732 (+) | 264 | WP_001177712.1 | hypothetical protein | Machinery gene |
| QAP07_RS05580 (QAP07_05580) | - | 1181743..1181979 (+) | 237 | WP_001183709.1 | hypothetical protein | - |
| QAP07_RS05585 (QAP07_05585) | - | 1181979..1184512 (+) | 2534 | Protein_1092 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| QAP07_RS05590 (QAP07_05590) | - | 1184525..1185784 (-) | 1260 | WP_286443611.1 | RNA-guided endonuclease TnpB family protein | - |
| QAP07_RS05595 (QAP07_05595) | - | 1185759..1186412 (-) | 654 | WP_286444025.1 | IS607-like element IS607 family transposase | - |
| QAP07_RS05600 (QAP07_05600) | - | 1186581..1186724 (+) | 144 | WP_286444069.1 | type IV secretion system protein VirB7 | - |
| QAP07_RS05605 (QAP07_05605) | - | 1186717..1187853 (+) | 1137 | WP_286444071.1 | VirB8/TrbF family protein | - |
| QAP07_RS05610 (QAP07_05610) | - | 1187850..1189511 (+) | 1662 | WP_286444072.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| QAP07_RS05615 (QAP07_05615) | - | 1189508..1190711 (+) | 1204 | Protein_1098 | DNA type IV secretion system protein ComB10 | - |
| QAP07_RS05620 (QAP07_05620) | - | 1190695..1192947 (+) | 2253 | WP_286444074.1 | collagen-like protein | - |
| QAP07_RS05625 (QAP07_05625) | - | 1192960..1193919 (+) | 960 | WP_286444076.1 | hypothetical protein | - |
| QAP07_RS05630 (QAP07_05630) | - | 1193937..1194209 (+) | 273 | WP_286444078.1 | hypothetical protein | - |
| QAP07_RS05635 (QAP07_05635) | - | 1194214..1195158 (+) | 945 | WP_121029715.1 | CpaF/VirB11 family protein | - |
| QAP07_RS05640 (QAP07_05640) | - | 1195155..1195673 (+) | 519 | WP_286444082.1 | replication regulatory RepB family protein | - |
| QAP07_RS05645 (QAP07_05645) | - | 1195670..1197934 (+) | 2265 | WP_286444084.1 | type IV secretory system conjugative DNA transfer family protein | - |
| QAP07_RS05650 (QAP07_05650) | - | 1197954..1198424 (+) | 471 | WP_286444086.1 | hypothetical protein | - |
| QAP07_RS05655 (QAP07_05655) | - | 1198452..1206530 (+) | 8079 | WP_286445174.1 | SNF2-related protein | - |
| QAP07_RS05660 (QAP07_05660) | - | 1206667..1206921 (+) | 255 | WP_000732628.1 | hypothetical protein | - |
| QAP07_RS05665 (QAP07_05665) | - | 1206914..1207138 (+) | 225 | WP_120914305.1 | hypothetical protein | - |
| QAP07_RS05670 (QAP07_05670) | - | 1207142..1207309 (+) | 168 | WP_001888325.1 | hypothetical protein | - |
| QAP07_RS05675 (QAP07_05675) | - | 1207276..1207527 (+) | 252 | WP_000528243.1 | hypothetical protein | - |
| QAP07_RS05680 (QAP07_05680) | - | 1207667..1209730 (+) | 2064 | WP_286444096.1 | type IA DNA topoisomerase | - |
| QAP07_RS05685 (QAP07_05685) | - | 1209785..1210255 (+) | 471 | WP_000965788.1 | hypothetical protein | - |
| QAP07_RS05690 (QAP07_05690) | - | 1210225..1211028 (+) | 804 | WP_000377503.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QAP07_RS05695 (QAP07_05695) | - | 1211102..1211767 (-) | 666 | WP_286444107.1 | hypothetical protein | - |
| QAP07_RS05700 (QAP07_05700) | - | 1211745..1212128 (-) | 384 | WP_038418524.1 | hypothetical protein | - |
| QAP07_RS05705 (QAP07_05705) | - | 1212175..1212843 (-) | 669 | Protein_1116 | ParA family protein | - |
| QAP07_RS05710 (QAP07_05710) | - | 1213480..1213644 (+) | 165 | WP_000189763.1 | hypothetical protein | - |
| QAP07_RS05715 (QAP07_05715) | - | 1213645..1214698 (+) | 1054 | Protein_1118 | ArdC family protein | - |
| QAP07_RS05720 (QAP07_05720) | - | 1214698..1216452 (+) | 1755 | Protein_1119 | hypothetical protein | - |
| QAP07_RS05725 (QAP07_05725) | - | 1216462..1217895 (+) | 1434 | WP_286444116.1 | hypothetical protein | - |
| QAP07_RS05730 (QAP07_05730) | - | 1217892..1219143 (+) | 1252 | Protein_1121 | P-type conjugative transfer protein TrbL | - |
| QAP07_RS05735 (QAP07_05735) | - | 1219140..1220398 (+) | 1259 | Protein_1122 | hypothetical protein | - |
| QAP07_RS05740 (QAP07_05740) | - | 1220420..1220899 (-) | 480 | WP_286444118.1 | hypothetical protein | - |
| QAP07_RS05745 (QAP07_05745) | - | 1220878..1221159 (-) | 282 | WP_286444121.1 | hypothetical protein | - |
| QAP07_RS05750 (QAP07_05750) | ctkA | 1221391..1222368 (+) | 978 | WP_286444123.1 | serine/threonine-protein kinase CtkA | - |
| QAP07_RS05755 (QAP07_05755) | - | 1222683..1223750 (-) | 1068 | WP_286444125.1 | tyrosine-type recombinase/integrase | - |
| QAP07_RS05760 (QAP07_05760) | - | 1224831..1226863 (-) | 2033 | Protein_1127 | relaxase/mobilization nuclease domain-containing protein | - |
| QAP07_RS05765 (QAP07_05765) | - | 1227724..1227855 (-) | 132 | WP_000093202.1 | hypothetical protein | - |
| QAP07_RS05770 (QAP07_05770) | - | 1227904..1228728 (-) | 825 | WP_000343437.1 | mechanosensitive ion channel family protein | - |
| QAP07_RS05775 (QAP07_05775) | - | 1228863..1229054 (-) | 192 | WP_120815502.1 | hypothetical protein | - |
| QAP07_RS05780 (QAP07_05780) | - | 1229642..1229809 (-) | 168 | WP_164858597.1 | hypothetical protein | - |
| QAP07_RS05785 (QAP07_05785) | - | 1229828..1230418 (-) | 591 | WP_286444131.1 | hypothetical protein | - |
| QAP07_RS05800 (QAP07_05800) | - | 1235223..1235717 (+) | 495 | WP_286444133.1 | hypothetical protein | - |
| QAP07_RS05805 (QAP07_05805) | - | 1235717..1237507 (+) | 1791 | WP_286444135.1 | DUF262 domain-containing protein | - |
| QAP07_RS05810 (QAP07_05810) | - | 1237658..1238560 (+) | 903 | WP_286444138.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10713.02 Da Isoelectric Point: 10.9123
>NTDB_id=817280 QAP07_RS05570 WP_048945574.1 1181174..1181458(+) (comB2) [Helicobacter pylori strain BS31]
MKKLSHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGTAIF
FKAPALANWFMSIF
MKKLSHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGTAIF
FKAPALANWFMSIF
Nucleotide
Download Length: 285 bp
>NTDB_id=817280 QAP07_RS05570 WP_048945574.1 1181174..1181458(+) (comB2) [Helicobacter pylori strain BS31]
ATGAAAAAATTAAGTCATTTTAGAAAGCTCATCGCCTTTTTAGGTTTTTCACCACTTTTACTACAAGCGGATATGACTAC
CTTTTTTAATAGTATTGAACAACAACTCACTAGCCCCACCGCTAAGGGTATTTTGATGGTCATTTTTTTAGGGCTTGCTA
TTTTTATATGGAAAAATTTAGACAGATGGAAAGAAATCTTAATGACAGTCCTTGCTATTGCCATAGGCACTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAATTGGTTTATGAGTATTTTTTAA
ATGAAAAAATTAAGTCATTTTAGAAAGCTCATCGCCTTTTTAGGTTTTTCACCACTTTTACTACAAGCGGATATGACTAC
CTTTTTTAATAGTATTGAACAACAACTCACTAGCCCCACCGCTAAGGGTATTTTGATGGTCATTTTTTTAGGGCTTGCTA
TTTTTATATGGAAAAATTTAGACAGATGGAAAGAAATCTTAATGACAGTCCTTGCTATTGCCATAGGCACTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAATTGGTTTATGAGTATTTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB2 | Helicobacter pylori 26695 |
57.143 |
96.809 |
0.553 |