Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   P4G50_RS18630 Genome accession   NZ_CP120958
Coordinates   3676630..3677409 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus cereus strain SCBCM001     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3651336..3713095 3676630..3677409 within 0


Gene organization within MGE regions


Location: 3651336..3713095
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P4G50_RS18520 - 3651906..3652805 (-) 900 WP_000868217.1 polysaccharide deacetylase family protein -
  P4G50_RS18525 pnp 3652957..3655095 (-) 2139 WP_000076737.1 polyribonucleotide nucleotidyltransferase -
  P4G50_RS18530 rpsO 3655256..3655525 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  P4G50_RS18535 ribF 3655626..3656597 (-) 972 WP_000766706.1 bifunctional riboflavin kinase/FAD synthetase -
  P4G50_RS18540 truB 3656641..3657564 (-) 924 WP_000399352.1 tRNA pseudouridine(55) synthase TruB -
  P4G50_RS18545 rbfA 3657651..3658007 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  P4G50_RS18550 - 3658023..3658304 (-) 282 WP_000582363.1 DUF503 family protein -
  P4G50_RS18555 infB 3658301..3660361 (-) 2061 WP_000036343.1 translation initiation factor IF-2 -
  P4G50_RS18560 - 3660366..3660677 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  P4G50_RS18565 - 3660678..3660950 (-) 273 WP_000071127.1 YlxR family protein -
  P4G50_RS18570 nusA 3660962..3662068 (-) 1107 WP_000102604.1 transcription termination factor NusA -
  P4G50_RS18575 rimP 3662086..3662556 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  P4G50_RS18580 - 3662893..3667194 (-) 4302 WP_000060005.1 PolC-type DNA polymerase III -
  P4G50_RS18585 - 3667319..3669019 (-) 1701 WP_000814302.1 proline--tRNA ligase -
  P4G50_RS18590 rseP 3669129..3670385 (-) 1257 WP_001090244.1 RIP metalloprotease RseP -
  P4G50_RS18595 dxr 3670403..3671545 (-) 1143 WP_000790373.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  P4G50_RS18600 cdsA 3671569..3672360 (-) 792 WP_000813592.1 phosphatidate cytidylyltransferase -
  P4G50_RS18605 uppS 3672378..3673154 (-) 777 WP_000971296.1 isoprenyl transferase -
  P4G50_RS18610 frr 3673240..3673797 (-) 558 WP_000531501.1 ribosome recycling factor -
  P4G50_RS18615 pyrH 3673800..3674522 (-) 723 WP_000042668.1 UMP kinase -
  P4G50_RS18620 tsf 3674589..3675476 (-) 888 WP_001018578.1 translation elongation factor Ts -
  P4G50_RS18625 rpsB 3675580..3676281 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  P4G50_RS18630 codY 3676630..3677409 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  P4G50_RS18635 hslU 3677487..3678878 (-) 1392 WP_000550078.1 ATP-dependent protease ATPase subunit HslU -
  P4G50_RS18640 hslV 3678901..3679443 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  P4G50_RS18645 xerC 3679486..3680385 (-) 900 WP_001101243.1 tyrosine recombinase XerC -
  P4G50_RS18650 trmFO 3680451..3681755 (-) 1305 WP_167316607.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  P4G50_RS18655 topA 3681804..3683882 (-) 2079 WP_001286963.1 type I DNA topoisomerase -
  P4G50_RS18660 dprA 3684027..3684896 (-) 870 WP_167316606.1 DNA-processing protein DprA -
  P4G50_RS18665 sucD 3684985..3685887 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  P4G50_RS18670 sucC 3685907..3687067 (-) 1161 WP_001020791.1 ADP-forming succinate--CoA ligase subunit beta -
  P4G50_RS18675 - 3687261..3688034 (-) 774 WP_001194265.1 ribonuclease HII -
  P4G50_RS18680 ylqF 3688091..3688981 (-) 891 WP_000236704.1 ribosome biogenesis GTPase YlqF -
  P4G50_RS18685 lepB 3689002..3689553 (-) 552 WP_065212075.1 signal peptidase I -
  P4G50_RS18690 rplS 3689655..3689999 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  P4G50_RS18695 trmD 3690146..3690880 (-) 735 WP_000686903.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  P4G50_RS18700 rimM 3690880..3691395 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  P4G50_RS18705 - 3691517..3691744 (-) 228 WP_000737401.1 KH domain-containing protein -
  P4G50_RS18710 rpsP 3691759..3692031 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  P4G50_RS18715 ffh 3692133..3693482 (-) 1350 WP_000863460.1 signal recognition particle protein -
  P4G50_RS18720 - 3693495..3693827 (-) 333 WP_000891062.1 putative DNA-binding protein -
  P4G50_RS18725 ftsY 3693961..3694950 (-) 990 WP_000007655.1 signal recognition particle-docking protein FtsY -
  P4G50_RS18730 smc 3694966..3698535 (-) 3570 WP_167316605.1 chromosome segregation protein SMC -
  P4G50_RS18735 rncS 3698682..3699419 (-) 738 WP_001146875.1 ribonuclease III -
  P4G50_RS18740 acpP 3699478..3699711 (-) 234 WP_000786062.1 acyl carrier protein -
  P4G50_RS18745 fabG 3699781..3700521 (-) 741 WP_000911773.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  P4G50_RS18750 fabD 3700521..3701465 (-) 945 WP_000515899.1 ACP S-malonyltransferase -
  P4G50_RS18755 plsX 3701480..3702472 (-) 993 WP_000684100.1 phosphate acyltransferase PlsX -
  P4G50_RS18760 fapR 3702469..3703062 (-) 594 WP_000747348.1 transcription factor FapR -
  P4G50_RS18765 recG 3703151..3705199 (-) 2049 WP_001000816.1 ATP-dependent DNA helicase RecG -
  P4G50_RS18770 - 3705490..3707166 (-) 1677 WP_000027129.1 DAK2 domain-containing protein -
  P4G50_RS18775 - 3707189..3707551 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  P4G50_RS18780 rpmB 3707928..3708116 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  P4G50_RS18785 spoVM 3708190..3708270 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  P4G50_RS18790 - 3708337..3709017 (-) 681 WP_002026234.1 thiamine diphosphokinase -
  P4G50_RS18795 rpe 3709086..3709730 (-) 645 WP_167316604.1 ribulose-phosphate 3-epimerase -
  P4G50_RS18800 rsgA 3709733..3710614 (-) 882 WP_001113932.1 ribosome small subunit-dependent GTPase A -
  P4G50_RS18805 pknB 3710862..3712835 (-) 1974 WP_000904747.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=809629 P4G50_RS18630 WP_000421290.1 3676630..3677409(-) (codY) [Bacillus cereus strain SCBCM001]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=809629 P4G50_RS18630 WP_000421290.1 3676630..3677409(-) (codY) [Bacillus cereus strain SCBCM001]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCGCGTAGTAAAGCTGTTGTTCAAATGGCAATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GCTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAAGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459