Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   OW489_RS00690 Genome accession   NZ_AP026446
Coordinates   151444..151569 (+) Length   41 a.a.
NCBI ID   WP_140483961.1    Uniprot ID   -
Organism   Helicobacter pylori strain CHC155     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 146444..156569
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OW489_RS00665 (CHC155_01330) - 146506..148728 (+) 2223 WP_267286028.1 ATP-dependent Clp protease ATP-binding subunit -
  OW489_RS00670 (CHC155_01340) panD 148718..149068 (+) 351 WP_140614051.1 aspartate 1-decarboxylase -
  OW489_RS00675 (CHC155_01350) - 149079..149372 (+) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  OW489_RS00680 (CHC155_01360) - 149372..150367 (+) 996 WP_267286195.1 PDZ domain-containing protein -
  OW489_RS00685 (CHC155_01370) comB6 150373..151428 (+) 1056 WP_267286196.1 P-type conjugative transfer protein TrbL Machinery gene
  OW489_RS00690 comB7 151444..151569 (+) 126 WP_140483961.1 comB7 lipoprotein Machinery gene
  OW489_RS00695 (CHC155_01380) comB8 151566..152309 (+) 744 WP_267286029.1 virB8 family protein Machinery gene
  OW489_RS00700 (CHC155_01390) comB9 152309..153274 (+) 966 WP_212778982.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  OW489_RS00705 (CHC155_01400) comB10 153267..154403 (+) 1137 WP_267286030.1 DNA type IV secretion system protein ComB10 Machinery gene
  OW489_RS00710 (CHC155_01410) - 154473..155885 (+) 1413 WP_267286031.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4770.78 Da        Isoelectric Point: 9.3278

>NTDB_id=80774 OW489_RS00690 WP_140483961.1 151444..151569(+) (comB7) [Helicobacter pylori strain CHC155]
MRIFSVIMGIMLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=80774 OW489_RS00690 WP_140483961.1 151444..151569(+) (comB7) [Helicobacter pylori strain CHC155]
ATGAGAATTTTTTCTGTCATTATGGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAACCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

80.488

100

0.805


Multiple sequence alignment