Detailed information NTG0805772

Bioinformatically predicted

Overview

• Name: ssbB
• Type: Machinery gene
• Locus tag: LLUC147_RS02195
• Genome accession: NZ_CP120473
• Coordinates: 440212..440601 (+)
• Length: 129 a.a.
• NCBI ID: WP_021165898.1
• Uniprot ID: A0A166Z4Y5
• Organism: Lactococcus cremoris strain UC147
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	440212..449995	440212..440601	within	0

Gene organization within MGE regions

Location: 440212..449995

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLUC147_RS02195 (LLUC147_02195)	ssbB	440212..440601 (+)	390	WP_021165898.1	single-stranded DNA-binding protein	Machinery gene
LLUC147_RS02200 (LLUC147_02200)	groES	440720..441004 (+)	285	WP_011675464.1	co-chaperone GroES	-
LLUC147_RS02205 (LLUC147_02205)	groL	441091..442719 (+)	1629	WP_021213999.1	chaperonin GroEL	-
LLUC147_RS02210 (LLUC147_02210)	-	442771..443583 (-)	813	WP_011675466.1	MBL fold metallo-hydrolase	-
LLUC147_RS02215 (LLUC147_02215)	-	443773..445200 (-)	1428	WP_134047241.1	cell wall metabolism sensor histidine kinase WalK	-
LLUC147_RS02220 (LLUC147_02220)	yycF	445193..445894 (-)	702	WP_003131580.1	response regulator YycF	-
LLUC147_RS02225 (LLUC147_02225)	tmk	446072..446707 (+)	636	WP_015082045.1	dTMP kinase	-
LLUC147_RS02230 (LLUC147_02230)	-	446840..447700 (+)	861	WP_011675470.1	DNA polymerase III subunit delta'	-
LLUC147_RS02235 (LLUC147_02235)	ricT	447750..448532 (+)	783	WP_011834464.1	stage 0 sporulation family protein	-
LLUC147_RS02240 (LLUC147_02240)	yabA	448525..448851 (+)	327	WP_011675472.1	DNA replication initiation control protein YabA	-
LLUC147_RS02245 (LLUC147_02245)	rsmI	448851..449726 (+)	876	WP_011834466.1	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	-
LLUC147_RS02250 (LLUC147_02250)	-	449804..449995 (-)	192	WP_011675474.1	hypothetical protein	-

Sequence

Protein

• Length: 129 a.a.
• Molecular weight: 14703.77 Da
• Isoelectric Point: 6.9865

>NTDB_id=805772 LLUC147_RS02195 WP_021165898.1 440212..440601(+) (ssbB) [Lactococcus cremoris strain UC147]
MNKTMLIGRLTNAPEISKTTNNKSYVRVTLAVNRRFKNEKGEREADFISIILWGKSAETFVSYAKKGSLISVEGEIRTRN
YTDKNEQKHCITEILGLSYDLLESRATLALRESAVNFEELLLEADELPF

Nucleotide

• Length: 390 bp

>NTDB_id=805772 LLUC147_RS02195 WP_021165898.1 440212..440601(+) (ssbB) [Lactococcus cremoris strain UC147]
ATGAATAAAACCATGTTGATTGGTCGTTTAACAAACGCACCTGAAATTTCGAAAACAACGAACAATAAATCTTATGTCCG
TGTGACTCTGGCAGTCAATCGCCGCTTCAAAAATGAAAAAGGAGAGCGAGAAGCAGACTTTATCTCGATAATTTTATGGG
GAAAATCAGCAGAAACATTCGTTTCCTATGCTAAAAAAGGAAGTCTTATTTCTGTAGAGGGAGAGATTAGAACTAGAAAT
TATACTGATAAAAATGAACAGAAACACTGTATTACAGAAATCTTAGGTTTGAGCTATGATTTATTGGAAAGTCGTGCGAC
TCTTGCCTTGAGAGAAAGCGCTGTAAATTTTGAGGAACTCTTACTTGAAGCTGATGAGCTCCCTTTCTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (1-95)

3D structure

• AlphaFold DB: A0A166Z4Y5

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbB	Lactococcus lactis subsp. cremoris KW2	96.899	100	0.969
ssbB	Streptococcus sobrinus strain NIDR 6715-7	60	100	0.605
ssbA	Streptococcus mutans UA159	56.154	100	0.566
ssbB/cilA	Streptococcus pneumoniae TIGR4	56.154	100	0.566
ssbB/cilA	Streptococcus mitis SK321	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae R6	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae Rx1	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae D39	55.385	100	0.558
ssbB/cilA	Streptococcus mitis NCTC 12261	55.385	100	0.558
ssb	Latilactobacillus sakei subsp. sakei 23K	41.964	86.822	0.364