Detailed information NTG0800526

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: P3K43_RS06955
• Genome accession: NZ_CP119698
• Coordinates: 1406052..1406375 (+)
• Length: 107 a.a.
• NCBI ID: WP_015729165.1
• Uniprot ID: -
• Organism: Staphylococcus pseudintermedius strain CUVET18-79
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1401052..1411375

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P3K43_RS06915	-	1401116..1401268 (-)	153	WP_100006908.1	ribbon-helix-helix domain-containing protein	-
P3K43_RS06920 (P3K43_06840)	-	1401399..1401791 (+)	393	WP_110148338.1	hypothetical protein	-
P3K43_RS06925 (P3K43_06845)	-	1401812..1402156 (+)	345	WP_100006906.1	hypothetical protein	-
P3K43_RS06930 (P3K43_06850)	-	1402158..1402646 (+)	489	WP_404951811.1	hypothetical protein	-
P3K43_RS06935 (P3K43_06855)	-	1402841..1403680 (+)	840	WP_100006904.1	hypothetical protein	-
P3K43_RS06940 (P3K43_06860)	-	1403693..1404298 (+)	606	WP_100006903.1	hypothetical protein	-
P3K43_RS06945 (P3K43_06865)	-	1404509..1405003 (+)	495	Protein_1333	ATPase, T2SS/T4P/T4SS family	-
P3K43_RS06950 (P3K43_06870)	comGB	1404972..1406039 (+)	1068	WP_096538140.1	competence type IV pilus assembly protein ComGB	-
P3K43_RS06955 (P3K43_06875)	comGC	1406052..1406375 (+)	324	WP_015729165.1	competence type IV pilus major pilin ComGC	Machinery gene
P3K43_RS06960 (P3K43_06880)	comGD	1406353..1406793 (+)	441	WP_014613823.1	competence type IV pilus minor pilin ComGD	-
P3K43_RS06965 (P3K43_06885)	-	1406898..1407098 (+)	201	WP_020219623.1	hypothetical protein	-
P3K43_RS06970 (P3K43_06890)	-	1407004..1407489 (+)	486	WP_080552896.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
P3K43_RS06975 (P3K43_06895)	-	1407653..1408180 (+)	528	WP_096538142.1	shikimate kinase	-
P3K43_RS06980 (P3K43_06900)	gcvT	1408338..1409429 (+)	1092	WP_015729161.1	glycine cleavage system aminomethyltransferase GcvT	-
P3K43_RS06985 (P3K43_06905)	gcvPA	1409442..1410791 (+)	1350	WP_014613828.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 107 a.a.
• Molecular weight: 12027.26 Da
• Isoelectric Point: 9.0966

>NTDB_id=800526 P3K43_RS06955 WP_015729165.1 1406052..1406375(+) (comGC) [Staphylococcus pseudintermedius strain CUVET18-79]
MIQQLKLKFNKKKGFTLIEMLLVLLIISVLLILIIPNIAKQSDHIQKTGCAAQLKMVDSQIEAYALKFNHKPNTIDDLVR
EGYIKESQKTCKSGEEITIRDGEAVAS

Nucleotide

• Length: 324 bp

>NTDB_id=800526 P3K43_RS06955 WP_015729165.1 1406052..1406375(+) (comGC) [Staphylococcus pseudintermedius strain CUVET18-79]
ATGATTCAACAACTTAAATTAAAATTCAACAAAAAGAAAGGTTTTACATTAATTGAAATGCTACTTGTTCTGTTAATTAT
TAGTGTACTATTGATTCTCATTATCCCGAATATTGCTAAGCAGTCAGATCATATCCAAAAAACGGGTTGTGCTGCACAAT
TAAAAATGGTCGATAGTCAAATAGAAGCCTATGCTTTAAAGTTTAACCACAAACCGAATACGATTGATGATTTAGTTCGT
GAAGGCTACATTAAAGAAAGTCAAAAAACATGCAAATCAGGTGAAGAGATCACAATCAGAGATGGCGAAGCAGTTGCGTC
ATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	73.529	95.327	0.701
comGC	Staphylococcus aureus N315	73.529	95.327	0.701
comGC/cglC	Streptococcus mitis SK321	44.898	91.589	0.411
comGC/cglC	Streptococcus pneumoniae D39	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae TIGR4	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae Rx1	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae R6	43.878	91.589	0.402
comYC	Streptococcus suis isolate S10	53.846	72.897	0.393
comYC	Streptococcus gordonii str. Challis substr. CH1	49.398	77.57	0.383
comGC	Bacillus subtilis subsp. subtilis str. 168	44.565	85.981	0.383
comGC/cglC	Streptococcus mitis NCTC 12261	48.78	76.636	0.374
comGC	Lactococcus lactis subsp. cremoris KW2	48.78	76.636	0.374