Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   P3K65_RS18730 Genome accession   NZ_CP119629
Coordinates   3680514..3681293 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus paranthracis strain Bc006     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3653893..3699925 3680514..3681293 within 0


Gene organization within MGE regions


Location: 3653893..3699925
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P3K65_RS18610 (P3K65_18610) - 3654087..3654338 (-) 252 WP_001239753.1 YlmC/YmxH family sporulation protein -
  P3K65_RS18615 (P3K65_18615) - 3654465..3655706 (-) 1242 WP_000592994.1 M16 family metallopeptidase -
  P3K65_RS18620 (P3K65_18620) - 3655793..3656692 (-) 900 WP_000857421.1 polysaccharide deacetylase family protein -
  P3K65_RS18625 (P3K65_18625) pnp 3656845..3658983 (-) 2139 WP_000076746.1 polyribonucleotide nucleotidyltransferase -
  P3K65_RS18630 (P3K65_18630) rpsO 3659144..3659413 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  P3K65_RS18635 (P3K65_18635) ribF 3659514..3660485 (-) 972 WP_000766710.1 bifunctional riboflavin kinase/FAD synthetase -
  P3K65_RS18640 (P3K65_18640) truB 3660529..3661452 (-) 924 WP_000399341.1 tRNA pseudouridine(55) synthase TruB -
  P3K65_RS18645 (P3K65_18645) rbfA 3661539..3661895 (-) 357 WP_000776443.1 30S ribosome-binding factor RbfA -
  P3K65_RS18650 (P3K65_18650) - 3661911..3662192 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  P3K65_RS18655 (P3K65_18655) infB 3662189..3664249 (-) 2061 WP_000036342.1 translation initiation factor IF-2 -
  P3K65_RS18660 (P3K65_18660) - 3664254..3664565 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  P3K65_RS18665 (P3K65_18665) rnpM 3664566..3664838 (-) 273 WP_000071128.1 RNase P modulator RnpM -
  P3K65_RS18670 (P3K65_18670) nusA 3664850..3665956 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  P3K65_RS18675 (P3K65_18675) rimP 3665974..3666444 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  P3K65_RS18680 (P3K65_18680) - 3666777..3671078 (-) 4302 WP_000059980.1 PolC-type DNA polymerase III -
  P3K65_RS18685 (P3K65_18685) - 3671203..3672903 (-) 1701 WP_000814314.1 proline--tRNA ligase -
  P3K65_RS18690 (P3K65_18690) rseP 3673013..3674269 (-) 1257 WP_001090249.1 RIP metalloprotease RseP -
  P3K65_RS18695 (P3K65_18695) dxr 3674286..3675428 (-) 1143 WP_000790362.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  P3K65_RS18700 (P3K65_18700) cdsA 3675452..3676243 (-) 792 WP_000813584.1 phosphatidate cytidylyltransferase -
  P3K65_RS18705 (P3K65_18705) uppS 3676261..3677037 (-) 777 WP_000971301.1 isoprenyl transferase -
  P3K65_RS18710 (P3K65_18710) frr 3677123..3677680 (-) 558 WP_000531500.1 ribosome recycling factor -
  P3K65_RS18715 (P3K65_18715) pyrH 3677683..3678405 (-) 723 WP_000042663.1 UMP kinase -
  P3K65_RS18720 (P3K65_18720) tsf 3678472..3679359 (-) 888 WP_001018580.1 translation elongation factor Ts -
  P3K65_RS18725 (P3K65_18725) rpsB 3679463..3680164 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  P3K65_RS18730 (P3K65_18730) codY 3680514..3681293 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  P3K65_RS18735 (P3K65_18735) hslU 3681371..3682762 (-) 1392 WP_000550081.1 ATP-dependent protease ATPase subunit HslU -
  P3K65_RS18740 (P3K65_18740) hslV 3682785..3683327 (-) 543 WP_000526271.1 ATP-dependent protease proteolytic subunit HslV -
  P3K65_RS18745 (P3K65_18745) xerC 3683370..3684269 (-) 900 WP_001101228.1 tyrosine recombinase XerC -
  P3K65_RS18750 (P3K65_18750) trmFO 3684335..3685639 (-) 1305 WP_001998091.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  P3K65_RS18755 (P3K65_18755) topA 3685690..3687768 (-) 2079 WP_001286973.1 type I DNA topoisomerase -
  P3K65_RS18760 (P3K65_18760) dprA 3687913..3688782 (-) 870 WP_000818025.1 DNA-processing protein DprA -
  P3K65_RS18765 (P3K65_18765) sucD 3688870..3689772 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  P3K65_RS18770 (P3K65_18770) sucC 3689792..3690952 (-) 1161 WP_001020785.1 ADP-forming succinate--CoA ligase subunit beta -
  P3K65_RS18775 (P3K65_18775) rnhB 3691146..3691919 (-) 774 WP_001174725.1 ribonuclease HII -
  P3K65_RS18780 (P3K65_18780) ylqF 3691971..3692861 (-) 891 WP_000236700.1 ribosome biogenesis GTPase YlqF -
  P3K65_RS18785 (P3K65_18785) lepB 3692882..3693433 (-) 552 WP_000711857.1 signal peptidase I -
  P3K65_RS18790 (P3K65_18790) rplS 3693535..3693879 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  P3K65_RS18795 (P3K65_18795) trmD 3694026..3694760 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  P3K65_RS18800 (P3K65_18800) rimM 3694760..3695275 (-) 516 WP_000170268.1 ribosome maturation factor RimM -
  P3K65_RS18805 (P3K65_18805) - 3695396..3695623 (-) 228 WP_000737403.1 KH domain-containing protein -
  P3K65_RS18810 (P3K65_18810) rpsP 3695638..3695910 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  P3K65_RS18815 (P3K65_18815) ffh 3696011..3697360 (-) 1350 WP_000863461.1 signal recognition particle protein -
  P3K65_RS18820 (P3K65_18820) - 3697373..3697705 (-) 333 WP_000891062.1 putative DNA-binding protein -
  P3K65_RS18825 (P3K65_18825) ftsY 3697839..3698828 (-) 990 WP_000007646.1 signal recognition particle-docking protein FtsY -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=800130 P3K65_RS18730 WP_000421288.1 3680514..3681293(-) (codY) [Bacillus paranthracis strain Bc006]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=800130 P3K65_RS18730 WP_000421288.1 3680514..3681293(-) (codY) [Bacillus paranthracis strain Bc006]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAGCGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGCTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATTGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCAGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTACTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459