Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   PZ893_RS18850 Genome accession   NZ_CP119300
Coordinates   3702383..3703162 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus cereus strain M72-4     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3677090..3738849 3702383..3703162 within 0


Gene organization within MGE regions


Location: 3677090..3738849
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PZ893_RS18740 (PZ893_18740) - 3677660..3678559 (-) 900 WP_000868217.1 polysaccharide deacetylase family protein -
  PZ893_RS18745 (PZ893_18745) pnp 3678711..3680849 (-) 2139 WP_000076737.1 polyribonucleotide nucleotidyltransferase -
  PZ893_RS18750 (PZ893_18750) rpsO 3681010..3681279 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  PZ893_RS18755 (PZ893_18755) ribF 3681380..3682351 (-) 972 WP_000766706.1 bifunctional riboflavin kinase/FAD synthetase -
  PZ893_RS18760 (PZ893_18760) truB 3682395..3683318 (-) 924 WP_000399352.1 tRNA pseudouridine(55) synthase TruB -
  PZ893_RS18765 (PZ893_18765) rbfA 3683405..3683761 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  PZ893_RS18770 (PZ893_18770) - 3683777..3684058 (-) 282 WP_000582363.1 DUF503 domain-containing protein -
  PZ893_RS18775 (PZ893_18775) infB 3684055..3686115 (-) 2061 WP_065382194.1 translation initiation factor IF-2 -
  PZ893_RS18780 (PZ893_18780) - 3686120..3686431 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  PZ893_RS18785 (PZ893_18785) rnpM 3686432..3686704 (-) 273 WP_000071127.1 RNase P modulator RnpM -
  PZ893_RS18790 (PZ893_18790) nusA 3686716..3687822 (-) 1107 WP_000102604.1 transcription termination factor NusA -
  PZ893_RS18795 (PZ893_18795) rimP 3687840..3688310 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  PZ893_RS18800 (PZ893_18800) - 3688647..3692948 (-) 4302 WP_000060005.1 PolC-type DNA polymerase III -
  PZ893_RS18805 (PZ893_18805) - 3693073..3694773 (-) 1701 WP_000814299.1 proline--tRNA ligase -
  PZ893_RS18810 (PZ893_18810) rseP 3694883..3696139 (-) 1257 WP_001090244.1 RIP metalloprotease RseP -
  PZ893_RS18815 (PZ893_18815) dxr 3696157..3697299 (-) 1143 WP_000790373.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  PZ893_RS18820 (PZ893_18820) cdsA 3697323..3698114 (-) 792 WP_000813592.1 phosphatidate cytidylyltransferase -
  PZ893_RS18825 (PZ893_18825) uppS 3698132..3698908 (-) 777 WP_000971296.1 isoprenyl transferase -
  PZ893_RS18830 (PZ893_18830) frr 3698994..3699551 (-) 558 WP_000531501.1 ribosome recycling factor -
  PZ893_RS18835 (PZ893_18835) pyrH 3699554..3700276 (-) 723 WP_000042668.1 UMP kinase -
  PZ893_RS18840 (PZ893_18840) tsf 3700343..3701230 (-) 888 WP_001018578.1 translation elongation factor Ts -
  PZ893_RS18845 (PZ893_18845) rpsB 3701334..3702035 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  PZ893_RS18850 (PZ893_18850) codY 3702383..3703162 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  PZ893_RS18855 (PZ893_18855) hslU 3703240..3704631 (-) 1392 WP_000550078.1 ATP-dependent protease ATPase subunit HslU -
  PZ893_RS18860 (PZ893_18860) hslV 3704654..3705196 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  PZ893_RS18865 (PZ893_18865) xerC 3705239..3706138 (-) 900 WP_001101243.1 tyrosine recombinase XerC -
  PZ893_RS18870 (PZ893_18870) trmFO 3706204..3707508 (-) 1305 WP_000213002.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  PZ893_RS18875 (PZ893_18875) topA 3707557..3709635 (-) 2079 WP_001286963.1 type I DNA topoisomerase -
  PZ893_RS18880 (PZ893_18880) dprA 3709780..3710649 (-) 870 WP_000818059.1 DNA-processing protein DprA -
  PZ893_RS18885 (PZ893_18885) sucD 3710738..3711640 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  PZ893_RS18890 (PZ893_18890) sucC 3711660..3712820 (-) 1161 WP_001020791.1 ADP-forming succinate--CoA ligase subunit beta -
  PZ893_RS18895 (PZ893_18895) - 3713015..3713788 (-) 774 WP_001194265.1 ribonuclease HII -
  PZ893_RS18900 (PZ893_18900) ylqF 3713845..3714735 (-) 891 WP_000236704.1 ribosome biogenesis GTPase YlqF -
  PZ893_RS18905 (PZ893_18905) lepB 3714756..3715307 (-) 552 WP_000711853.1 signal peptidase I -
  PZ893_RS18910 (PZ893_18910) rplS 3715409..3715753 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  PZ893_RS18915 (PZ893_18915) trmD 3715900..3716634 (-) 735 WP_000686903.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  PZ893_RS18920 (PZ893_18920) rimM 3716634..3717149 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  PZ893_RS18925 (PZ893_18925) - 3717271..3717498 (-) 228 WP_000737401.1 KH domain-containing protein -
  PZ893_RS18930 (PZ893_18930) rpsP 3717513..3717785 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  PZ893_RS18935 (PZ893_18935) ffh 3717887..3719236 (-) 1350 WP_000863460.1 signal recognition particle protein -
  PZ893_RS18940 (PZ893_18940) - 3719249..3719581 (-) 333 WP_000891062.1 putative DNA-binding protein -
  PZ893_RS18945 (PZ893_18945) ftsY 3719715..3720704 (-) 990 WP_000007655.1 signal recognition particle-docking protein FtsY -
  PZ893_RS18950 (PZ893_18950) smc 3720720..3724289 (-) 3570 WP_000478978.1 chromosome segregation protein SMC -
  PZ893_RS18955 (PZ893_18955) rncS 3724436..3725173 (-) 738 WP_001146875.1 ribonuclease III -
  PZ893_RS18960 (PZ893_18960) acpP 3725232..3725465 (-) 234 WP_000786062.1 acyl carrier protein -
  PZ893_RS18965 (PZ893_18965) fabG 3725535..3726275 (-) 741 WP_000911773.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  PZ893_RS18970 (PZ893_18970) fabD 3726275..3727219 (-) 945 WP_000515899.1 ACP S-malonyltransferase -
  PZ893_RS18975 (PZ893_18975) plsX 3727234..3728226 (-) 993 WP_000684100.1 phosphate acyltransferase PlsX -
  PZ893_RS18980 (PZ893_18980) fapR 3728223..3728816 (-) 594 WP_000747348.1 transcription factor FapR -
  PZ893_RS18985 (PZ893_18985) recG 3728905..3730953 (-) 2049 WP_065212076.1 ATP-dependent DNA helicase RecG -
  PZ893_RS18990 (PZ893_18990) - 3731244..3732920 (-) 1677 WP_000027129.1 DAK2 domain-containing protein -
  PZ893_RS18995 (PZ893_18995) - 3732943..3733305 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  PZ893_RS19000 (PZ893_19000) rpmB 3733682..3733870 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  PZ893_RS19005 (PZ893_19005) spoVM 3733944..3734024 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  PZ893_RS19010 (PZ893_19010) - 3734091..3734771 (-) 681 WP_000752665.1 thiamine diphosphokinase -
  PZ893_RS19015 (PZ893_19015) rpe 3734841..3735485 (-) 645 WP_065212077.1 ribulose-phosphate 3-epimerase -
  PZ893_RS19020 (PZ893_19020) rsgA 3735488..3736369 (-) 882 WP_065212078.1 ribosome small subunit-dependent GTPase A -
  PZ893_RS19025 (PZ893_19025) pknB 3736616..3738589 (-) 1974 WP_000904747.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=798355 PZ893_RS18850 WP_000421290.1 3702383..3703162(-) (codY) [Bacillus cereus strain M72-4]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=798355 PZ893_RS18850 WP_000421290.1 3702383..3703162(-) (codY) [Bacillus cereus strain M72-4]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCGCGTAGTAAAGCTGTTGTTCAAATGGCAATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GCTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAAGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459