Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   Q2B68_RS13355 Genome accession   NZ_CP130280
Coordinates   2712852..2713166 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain PM415     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2707852..2718166
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q2B68_RS13310 (Q2B68_13310) sinI 2708535..2708708 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  Q2B68_RS13315 (Q2B68_13315) sinR 2708742..2709077 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  Q2B68_RS13320 (Q2B68_13320) tasA 2709125..2709910 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  Q2B68_RS13325 (Q2B68_13325) sipW 2709974..2710558 (-) 585 WP_012117977.1 signal peptidase I SipW -
  Q2B68_RS13330 (Q2B68_13330) tapA 2710530..2711201 (-) 672 WP_165625718.1 amyloid fiber anchoring/assembly protein TapA -
  Q2B68_RS13335 (Q2B68_13335) - 2711460..2711789 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  Q2B68_RS13340 (Q2B68_13340) - 2711829..2712008 (-) 180 WP_003153093.1 YqzE family protein -
  Q2B68_RS13345 (Q2B68_13345) comGG 2712065..2712442 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  Q2B68_RS13350 (Q2B68_13350) comGF 2712443..2712943 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF Machinery gene
  Q2B68_RS13355 (Q2B68_13355) comGE 2712852..2713166 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  Q2B68_RS13360 (Q2B68_13360) comGD 2713150..2713587 (-) 438 WP_224462754.1 competence type IV pilus minor pilin ComGD Machinery gene
  Q2B68_RS13365 (Q2B68_13365) comGC 2713577..2713885 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  Q2B68_RS13370 (Q2B68_13370) comGB 2713890..2714927 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  Q2B68_RS13375 (Q2B68_13375) comGA 2714914..2715984 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  Q2B68_RS13380 (Q2B68_13380) - 2716176..2717126 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=781786 Q2B68_RS13355 WP_015388003.1 2712852..2713166(-) (comGE) [Bacillus amyloliquefaciens strain PM415]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=781786 Q2B68_RS13355 WP_015388003.1 2712852..2713166(-) (comGE) [Bacillus amyloliquefaciens strain PM415]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481