Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   PPM66_RS14740 Genome accession   NZ_CP116867
Coordinates   2804947..2805114 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis subsp. subtilis strain MGP008     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 2799947..2810114
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PPM66_RS14710 mrpE 2800342..2800818 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  PPM66_RS14715 mrpF 2800818..2801102 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  PPM66_RS14720 mnhG 2801086..2801460 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  PPM66_RS14725 yuxO 2801499..2801879 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  PPM66_RS14730 comA 2801898..2802542 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  PPM66_RS14735 comP 2802623..2804932 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  PPM66_RS14740 comX 2804947..2805114 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  PPM66_RS14745 comQ 2805102..2806001 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  PPM66_RS14750 degQ 2806186..2806326 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  PPM66_RS14755 - 2806548..2806673 (+) 126 WP_003228793.1 hypothetical protein -
  PPM66_RS14760 - 2806787..2807155 (+) 369 WP_003243784.1 hypothetical protein -
  PPM66_RS14765 pdeH 2807131..2808360 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  PPM66_RS14770 pncB 2808497..2809969 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=780486 PPM66_RS14740 WP_003242801.1 2804947..2805114(-) (comX) [Bacillus subtilis subsp. subtilis strain MGP008]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=780486 PPM66_RS14740 WP_003242801.1 2804947..2805114(-) (comX) [Bacillus subtilis subsp. subtilis strain MGP008]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1