NTDB

Overview

Name	ssbA	Type	Machinery gene
Locus tag	POF61_RS01220	Genome accession	NZ_CP116709
Coordinates	201207..201602 (+)	Length	131 a.a.
NCBI ID	WP_038406053.1	Uniprot ID	-
Organism	Streptococcus agalactiae strain CNCTC 10/84 sCas9revertant
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 196207..206602

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
POF61_RS01185 (POF61_01185)	proC	196606..197376 (-)	771	WP_001876660.1	pyrroline-5-carboxylate reductase	-
POF61_RS01190 (POF61_01190)	pepA	197446..198513 (-)	1068	WP_001281322.1	glutamyl aminopeptidase	-
POF61_RS01195 (POF61_01195)	-	198693..198932 (-)	240	WP_000660180.1	hypothetical protein	-
POF61_RS01200 (POF61_01200)	-	199093..199377 (+)	285	WP_000791272.1	DUF4651 domain-containing protein	-
POF61_RS01205 (POF61_01205)	-	199374..199697 (+)	324	WP_000602780.1	thioredoxin family protein	-
POF61_RS01210 (POF61_01210)	ytpR	199730..200356 (+)	627	WP_000578323.1	YtpR family tRNA-binding protein	-
POF61_RS01215 (POF61_01215)	-	200410..201126 (-)	717	Protein_183	class I SAM-dependent methyltransferase	-
POF61_RS01220 (POF61_01220)	ssbA	201207..201602 (+)	396	WP_038406053.1	single-stranded DNA-binding protein	Machinery gene
POF61_RS01225 (POF61_01225)	-	201726..202370 (+)	645	WP_000416608.1	HAD family hydrolase	-
POF61_RS01230 (POF61_01230)	-	202397..204142 (+)	1746	WP_000930334.1	LytS/YhcK type 5TM receptor domain-containing protein	-
POF61_RS01235 (POF61_01235)	-	204123..204863 (+)	741	WP_000697631.1	LytTR family transcriptional regulator DNA-binding domain-containing protein	-
POF61_RS01240 (POF61_01240)	-	205033..205488 (+)	456	WP_000683316.1	CidA/LrgA family protein	-
POF61_RS01245 (POF61_01245)	lrgB	205490..206218 (+)	729	WP_000421726.1	antiholin-like protein LrgB	-

Sequence

Protein

Download Length: 131 a.a. Molecular weight: 14838.84 Da Isoelectric Point: 7.0189

                                >NTDB_id=779356 POF61_RS01220 WP_038406053.1 201207..201602(+) (ssbA) [Streptococcus agalactiae strain CNCTC 10/84 sCas9revertant]

MYNKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWGRLAETFASYGTKGSLISIDGELRTR

KYEKDGQTHYITEVLASSFQLLESRAQRAMRENNVSSDLSDLVLEEEELPF

Nucleotide

Download Length: 396 bp

                                >NTDB_id=779356 POF61_RS01220 WP_038406053.1 201207..201602(+) (ssbA) [Streptococcus agalactiae strain CNCTC 10/84 sCas9revertant]

ATGTATAATAAAGTTATTATGATTGGGCGTCTAACAGCAAAGCCTGAGATGGTAAAAACACCAACTGACAAGTCAGTAAC

GCGTGCAACTGTTGCTGTTAATAGACGCTTTAAAGGAAGTAATGGTGAGCGTGAAGCAGATTTTATTAATGTGGTTATGT

GGGGTCGTCTAGCGGAAACCTTTGCGAGCTATGGGACAAAGGGCTCTTTAATTTCAATAGATGGTGAATTACGTACGCGC

AAGTACGAAAAGGATGGTCAAACGCACTATATTACTGAAGTATTAGCATCATCATTTCAGTTGCTAGAAAGCCGTGCCCA

ACGTGCTATGCGTGAAAATAATGTTTCTAGTGATTTGTCAGATTTAGTATTGGAAGAAGAGGAGCTCCCCTTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(3-102)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbA	Streptococcus mutans UA159	80.916	100	0.809
ssbB	Streptococcus sobrinus strain NIDR 6715-7	77.099	100	0.771
ssbB/cilA	Streptococcus pneumoniae Rx1	77.099	100	0.771
ssbB/cilA	Streptococcus pneumoniae D39	77.099	100	0.771
ssbB/cilA	Streptococcus pneumoniae R6	77.099	100	0.771
ssbB/cilA	Streptococcus pneumoniae TIGR4	76.336	100	0.763
ssbB/cilA	Streptococcus mitis NCTC 12261	75.573	100	0.756
ssbB/cilA	Streptococcus mitis SK321	75.573	100	0.756
ssbB	Lactococcus lactis subsp. cremoris KW2	58.621	88.55	0.519
ssb	Latilactobacillus sakei subsp. sakei 23K	45.763	90.076	0.412
ssbA	Bacillus subtilis subsp. subtilis str. 168	50.943	80.916	0.412

Detailed information NTG0779356