Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   PJW01_RS16320 Genome accession   NZ_CP116325
Coordinates   3179887..3180666 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus thuringiensis strain BLB1     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3164441..3222112 3179887..3180666 within 0


Gene organization within MGE regions


Location: 3164441..3222112
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PJW01_RS16265 (PJW01_16265) rimP 3165343..3165813 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  PJW01_RS16270 (PJW01_16270) - 3166150..3170451 (-) 4302 WP_000060004.1 PolC-type DNA polymerase III -
  PJW01_RS16275 (PJW01_16275) - 3170576..3172276 (-) 1701 WP_000814333.1 proline--tRNA ligase -
  PJW01_RS16280 (PJW01_16280) rseP 3172386..3173642 (-) 1257 WP_001090245.1 RIP metalloprotease RseP -
  PJW01_RS16285 (PJW01_16285) dxr 3173660..3174802 (-) 1143 WP_000790372.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  PJW01_RS16290 (PJW01_16290) cdsA 3174826..3175617 (-) 792 WP_000813592.1 phosphatidate cytidylyltransferase -
  PJW01_RS16295 (PJW01_16295) uppS 3175635..3176411 (-) 777 WP_000971296.1 isoprenyl transferase -
  PJW01_RS16300 (PJW01_16300) frr 3176497..3177054 (-) 558 WP_000531501.1 ribosome recycling factor -
  PJW01_RS16305 (PJW01_16305) pyrH 3177057..3177779 (-) 723 WP_000042668.1 UMP kinase -
  PJW01_RS16310 (PJW01_16310) tsf 3177846..3178733 (-) 888 WP_001018578.1 translation elongation factor Ts -
  PJW01_RS16315 (PJW01_16315) rpsB 3178837..3179538 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  PJW01_RS16320 (PJW01_16320) codY 3179887..3180666 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  PJW01_RS16325 (PJW01_16325) hslU 3180744..3182135 (-) 1392 WP_000550087.1 ATP-dependent protease ATPase subunit HslU -
  PJW01_RS16330 (PJW01_16330) hslV 3182158..3182700 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  PJW01_RS16335 (PJW01_16335) xerC 3182743..3183642 (-) 900 WP_001101241.1 tyrosine recombinase XerC -
  PJW01_RS16340 (PJW01_16340) trmFO 3183708..3185012 (-) 1305 WP_000213002.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  PJW01_RS16345 (PJW01_16345) topA 3185061..3187139 (-) 2079 WP_001286963.1 type I DNA topoisomerase -
  PJW01_RS16350 (PJW01_16350) dprA 3187284..3188153 (-) 870 WP_000818039.1 DNA-processing protein DprA -
  PJW01_RS16355 (PJW01_16355) sucD 3188241..3189143 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  PJW01_RS16360 (PJW01_16360) sucC 3189163..3190323 (-) 1161 WP_001020791.1 ADP-forming succinate--CoA ligase subunit beta -
  PJW01_RS16365 (PJW01_16365) - 3190518..3191291 (-) 774 WP_001193513.1 ribonuclease HII -
  PJW01_RS16370 (PJW01_16370) ylqF 3191348..3192238 (-) 891 WP_000236702.1 ribosome biogenesis GTPase YlqF -
  PJW01_RS16375 (PJW01_16375) lepB 3192259..3192810 (-) 552 WP_000711851.1 signal peptidase I -
  PJW01_RS16380 (PJW01_16380) rplS 3192912..3193256 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  PJW01_RS16385 (PJW01_16385) trmD 3193403..3194137 (-) 735 WP_000686903.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  PJW01_RS16390 (PJW01_16390) rimM 3194137..3194652 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  PJW01_RS16395 (PJW01_16395) - 3194773..3195000 (-) 228 WP_000737401.1 KH domain-containing protein -
  PJW01_RS16400 (PJW01_16400) rpsP 3195015..3195287 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  PJW01_RS16405 (PJW01_16405) ffh 3195389..3196738 (-) 1350 WP_000863460.1 signal recognition particle protein -
  PJW01_RS16410 (PJW01_16410) - 3196751..3197083 (-) 333 WP_000891062.1 putative DNA-binding protein -
  PJW01_RS16415 (PJW01_16415) ftsY 3197217..3198206 (-) 990 WP_000007655.1 signal recognition particle-docking protein FtsY -
  PJW01_RS16420 (PJW01_16420) smc 3198222..3201329 (-) 3108 Protein_3257 chromosome segregation protein SMC -
  PJW01_RS16425 (PJW01_16425) ltrA 3201427..3203232 (-) 1806 WP_000108316.1 group II intron reverse transcriptase/maturase -
  PJW01_RS16430 (PJW01_16430) - 3203936..3204397 (-) 462 Protein_3259 AAA family ATPase -
  PJW01_RS16435 (PJW01_16435) rncS 3204544..3205281 (-) 738 WP_001146875.1 ribonuclease III -
  PJW01_RS16440 (PJW01_16440) acpP 3205340..3205573 (-) 234 WP_000786062.1 acyl carrier protein -
  PJW01_RS16445 (PJW01_16445) fabG 3205643..3206383 (-) 741 WP_000911768.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  PJW01_RS16450 (PJW01_16450) fabD 3206383..3207327 (-) 945 WP_000515905.1 ACP S-malonyltransferase -
  PJW01_RS16455 (PJW01_16455) plsX 3207342..3208334 (-) 993 WP_000684098.1 phosphate acyltransferase PlsX -
  PJW01_RS16460 (PJW01_16460) fapR 3208331..3208924 (-) 594 WP_000747349.1 transcription factor FapR -
  PJW01_RS16465 (PJW01_16465) recG 3209013..3211061 (-) 2049 WP_001000811.1 ATP-dependent DNA helicase RecG -
  PJW01_RS16470 (PJW01_16470) - 3211352..3213028 (-) 1677 WP_000027129.1 DAK2 domain-containing protein -
  PJW01_RS16475 (PJW01_16475) - 3213051..3213413 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  PJW01_RS16480 (PJW01_16480) rpmB 3213790..3213978 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  PJW01_RS16485 (PJW01_16485) spoVM 3214052..3214132 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  PJW01_RS16490 (PJW01_16490) - 3214199..3214879 (-) 681 WP_002132739.1 thiamine diphosphokinase -
  PJW01_RS16495 (PJW01_16495) rpe 3214949..3215593 (-) 645 WP_000589974.1 ribulose-phosphate 3-epimerase -
  PJW01_RS16500 (PJW01_16500) rsgA 3215596..3216477 (-) 882 WP_001113932.1 ribosome small subunit-dependent GTPase A -
  PJW01_RS16505 (PJW01_16505) pknB 3216724..3218697 (-) 1974 WP_000904748.1 Stk1 family PASTA domain-containing Ser/Thr kinase -
  PJW01_RS16510 (PJW01_16510) - 3218706..3219458 (-) 753 WP_000648703.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  PJW01_RS16515 (PJW01_16515) rlmN 3219463..3220551 (-) 1089 WP_000450541.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  PJW01_RS16520 (PJW01_16520) rsmB 3220556..3221890 (-) 1335 WP_001249668.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=776615 PJW01_RS16320 WP_000421290.1 3179887..3180666(-) (codY) [Bacillus thuringiensis strain BLB1]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=776615 PJW01_RS16320 WP_000421290.1 3179887..3180666(-) (codY) [Bacillus thuringiensis strain BLB1]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCACGTAGTAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAGTTAGAAGCGAT
TGAGCACATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GTTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAGGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459