Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   PGS39_RS19070 Genome accession   NZ_CP116204
Coordinates   3694190..3694969 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus paranthracis strain NVH_0075/95     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3667569..3713604 3694190..3694969 within 0


Gene organization within MGE regions


Location: 3667569..3713604
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PGS39_RS18950 (PGS39_18950) - 3667763..3668014 (-) 252 WP_001239754.1 YlmC/YmxH family sporulation protein -
  PGS39_RS18955 (PGS39_18955) - 3668141..3669382 (-) 1242 WP_000592994.1 M16 family metallopeptidase -
  PGS39_RS18960 (PGS39_18960) - 3669469..3670368 (-) 900 WP_000647527.1 polysaccharide deacetylase family protein -
  PGS39_RS18965 (PGS39_18965) pnp 3670520..3672658 (-) 2139 WP_000076746.1 polyribonucleotide nucleotidyltransferase -
  PGS39_RS18970 (PGS39_18970) rpsO 3672819..3673088 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  PGS39_RS18975 (PGS39_18975) ribF 3673189..3674160 (-) 972 WP_000766710.1 bifunctional riboflavin kinase/FAD synthetase -
  PGS39_RS18980 (PGS39_18980) truB 3674204..3675127 (-) 924 WP_000399344.1 tRNA pseudouridine(55) synthase TruB -
  PGS39_RS18985 (PGS39_18985) rbfA 3675214..3675570 (-) 357 WP_000776440.1 30S ribosome-binding factor RbfA -
  PGS39_RS18990 (PGS39_18990) - 3675586..3675867 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  PGS39_RS18995 (PGS39_18995) infB 3675864..3677924 (-) 2061 WP_000036342.1 translation initiation factor IF-2 -
  PGS39_RS19000 (PGS39_19000) - 3677929..3678240 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  PGS39_RS19005 (PGS39_19005) rnpM 3678241..3678513 (-) 273 WP_000071128.1 RNase P modulator RnpM -
  PGS39_RS19010 (PGS39_19010) nusA 3678525..3679631 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  PGS39_RS19015 (PGS39_19015) rimP 3679649..3680119 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  PGS39_RS19020 (PGS39_19020) - 3680452..3684753 (-) 4302 WP_000059980.1 PolC-type DNA polymerase III -
  PGS39_RS19025 (PGS39_19025) - 3684878..3686578 (-) 1701 WP_000814305.1 proline--tRNA ligase -
  PGS39_RS19030 (PGS39_19030) rseP 3686688..3687944 (-) 1257 WP_001090248.1 RIP metalloprotease RseP -
  PGS39_RS19035 (PGS39_19035) dxr 3687961..3689103 (-) 1143 WP_000790362.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  PGS39_RS19040 (PGS39_19040) cdsA 3689127..3689918 (-) 792 WP_000813584.1 phosphatidate cytidylyltransferase -
  PGS39_RS19045 (PGS39_19045) uppS 3689936..3690712 (-) 777 WP_000971301.1 isoprenyl transferase -
  PGS39_RS19050 (PGS39_19050) frr 3690798..3691355 (-) 558 WP_000531500.1 ribosome recycling factor -
  PGS39_RS19055 (PGS39_19055) pyrH 3691358..3692080 (-) 723 WP_000042663.1 UMP kinase -
  PGS39_RS19060 (PGS39_19060) tsf 3692147..3693034 (-) 888 WP_001018580.1 translation elongation factor Ts -
  PGS39_RS19065 (PGS39_19065) rpsB 3693138..3693839 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  PGS39_RS19070 (PGS39_19070) codY 3694190..3694969 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  PGS39_RS19075 (PGS39_19075) hslU 3695047..3696438 (-) 1392 WP_000550081.1 ATP-dependent protease ATPase subunit HslU -
  PGS39_RS19080 (PGS39_19080) hslV 3696461..3697003 (-) 543 WP_000526271.1 ATP-dependent protease proteolytic subunit HslV -
  PGS39_RS19085 (PGS39_19085) xerC 3697046..3697945 (-) 900 WP_001101229.1 tyrosine recombinase XerC -
  PGS39_RS19090 (PGS39_19090) trmFO 3698011..3699315 (-) 1305 WP_002028254.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  PGS39_RS19095 (PGS39_19095) topA 3699366..3701444 (-) 2079 WP_001286973.1 type I DNA topoisomerase -
  PGS39_RS19100 (PGS39_19100) dprA 3701589..3702458 (-) 870 WP_000818031.1 DNA-processing protein DprA -
  PGS39_RS19105 (PGS39_19105) sucD 3702546..3703448 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  PGS39_RS19110 (PGS39_19110) sucC 3703468..3704628 (-) 1161 WP_001020785.1 ADP-forming succinate--CoA ligase subunit beta -
  PGS39_RS19115 (PGS39_19115) rnhB 3704822..3705595 (-) 774 WP_001174725.1 ribonuclease HII -
  PGS39_RS19120 (PGS39_19120) ylqF 3705647..3706537 (-) 891 WP_000236700.1 ribosome biogenesis GTPase YlqF -
  PGS39_RS19125 (PGS39_19125) lepB 3706558..3707109 (-) 552 WP_000711857.1 signal peptidase I -
  PGS39_RS19130 (PGS39_19130) rplS 3707211..3707555 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  PGS39_RS19135 (PGS39_19135) trmD 3707702..3708436 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  PGS39_RS19140 (PGS39_19140) rimM 3708436..3708951 (-) 516 WP_000170268.1 ribosome maturation factor RimM -
  PGS39_RS19145 (PGS39_19145) - 3709075..3709302 (-) 228 WP_000737403.1 KH domain-containing protein -
  PGS39_RS19150 (PGS39_19150) rpsP 3709317..3709589 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  PGS39_RS19155 (PGS39_19155) ffh 3709690..3711039 (-) 1350 WP_000863461.1 signal recognition particle protein -
  PGS39_RS19160 (PGS39_19160) - 3711052..3711384 (-) 333 WP_000891062.1 putative DNA-binding protein -
  PGS39_RS19165 (PGS39_19165) ftsY 3711518..3712507 (-) 990 WP_000007646.1 signal recognition particle-docking protein FtsY -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=776151 PGS39_RS19070 WP_000421288.1 3694190..3694969(-) (codY) [Bacillus paranthracis strain NVH_0075/95]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=776151 PGS39_RS19070 WP_000421288.1 3694190..3694969(-) (codY) [Bacillus paranthracis strain NVH_0075/95]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAGCGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGCTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATTGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTACTAAACGACAAATTCTTACATGAACTTGCTAAATTGAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459