Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   PCT00_RS18985 Genome accession   NZ_CP115870
Coordinates   3641442..3642221 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus anthracis strain IAL 52     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3607120..3681043 3641442..3642221 within 0


Gene organization within MGE regions


Location: 3607120..3681043
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PCT00_RS18835 (PCT00_18805) - 3607464..3609134 (-) 1671 WP_000823085.1 ribonuclease J -
  PCT00_RS18840 (PCT00_18810) dapA 3609900..3610778 (-) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  PCT00_RS18845 (PCT00_18815) dapG 3610790..3612022 (-) 1233 WP_000692470.1 aspartate kinase -
  PCT00_RS18850 (PCT00_18820) asd 3612046..3613092 (-) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  PCT00_RS18855 (PCT00_18825) dpaB 3613243..3613842 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  PCT00_RS18860 (PCT00_18830) dpaA 3613839..3614741 (-) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  PCT00_RS18865 (PCT00_18835) - 3615016..3615267 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  PCT00_RS18870 (PCT00_18840) - 3615394..3616635 (-) 1242 WP_000592993.1 pitrilysin family protein -
  PCT00_RS18875 (PCT00_18845) - 3616722..3617621 (-) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  PCT00_RS18880 (PCT00_18850) pnp 3617773..3619911 (-) 2139 WP_000076733.1 polyribonucleotide nucleotidyltransferase -
  PCT00_RS18885 (PCT00_18855) rpsO 3620072..3620341 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  PCT00_RS18890 (PCT00_18860) ribF 3620442..3621413 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  PCT00_RS18895 (PCT00_18865) truB 3621457..3622380 (-) 924 WP_000399357.1 tRNA pseudouridine(55) synthase TruB -
  PCT00_RS18900 (PCT00_18870) rbfA 3622467..3622823 (-) 357 WP_000776446.1 30S ribosome-binding factor RbfA -
  PCT00_RS18905 (PCT00_18875) - 3622839..3623120 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  PCT00_RS18910 (PCT00_18880) infB 3623117..3625177 (-) 2061 WP_000036339.1 translation initiation factor IF-2 -
  PCT00_RS18915 (PCT00_18885) - 3625182..3625493 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  PCT00_RS18920 (PCT00_18890) rnpM 3625494..3625766 (-) 273 WP_000071128.1 RNase P modulator RnpM -
  PCT00_RS18925 (PCT00_18895) nusA 3625778..3626884 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  PCT00_RS18930 (PCT00_18900) rimP 3626902..3627372 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  PCT00_RS18935 (PCT00_18905) - 3627705..3632006 (-) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  PCT00_RS18940 (PCT00_18910) - 3632131..3633831 (-) 1701 WP_000814312.1 proline--tRNA ligase -
  PCT00_RS18945 (PCT00_18915) rseP 3633941..3635197 (-) 1257 WP_001090228.1 RIP metalloprotease RseP -
  PCT00_RS18950 (PCT00_18920) dxr 3635214..3636356 (-) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  PCT00_RS18955 (PCT00_18925) cdsA 3636380..3637171 (-) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  PCT00_RS18960 (PCT00_18930) uppS 3637189..3637965 (-) 777 WP_000971303.1 isoprenyl transferase -
  PCT00_RS18965 (PCT00_18935) frr 3638051..3638608 (-) 558 WP_000531503.1 ribosome recycling factor -
  PCT00_RS18970 (PCT00_18940) pyrH 3638611..3639333 (-) 723 WP_000042663.1 UMP kinase -
  PCT00_RS18975 (PCT00_18945) tsf 3639400..3640287 (-) 888 WP_001018581.1 translation elongation factor Ts -
  PCT00_RS18980 (PCT00_18950) rpsB 3640391..3641092 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  PCT00_RS18985 (PCT00_18955) codY 3641442..3642221 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  PCT00_RS18990 (PCT00_18960) hslU 3642299..3643690 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  PCT00_RS18995 (PCT00_18965) hslV 3643713..3644255 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  PCT00_RS19000 (PCT00_18970) xerC 3644298..3645197 (-) 900 WP_001101226.1 tyrosine recombinase XerC -
  PCT00_RS19005 (PCT00_18975) trmFO 3645263..3646567 (-) 1305 WP_003161605.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  PCT00_RS19010 (PCT00_18980) topA 3646618..3648696 (-) 2079 WP_001286969.1 type I DNA topoisomerase -
  PCT00_RS19015 (PCT00_18985) dprA 3648841..3649589 (-) 749 Protein_3703 DNA-processing protein DprA -
  PCT00_RS19020 (PCT00_18990) sucD 3649797..3650699 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  PCT00_RS19025 (PCT00_18995) sucC 3650720..3651880 (-) 1161 WP_001020786.1 ADP-forming succinate--CoA ligase subunit beta -
  PCT00_RS19030 (PCT00_19000) rnhB 3652074..3652847 (-) 774 WP_025706620.1 ribonuclease HII -
  PCT00_RS19035 (PCT00_19005) ylqF 3652899..3653789 (-) 891 WP_000236707.1 ribosome biogenesis GTPase YlqF -
  PCT00_RS19040 (PCT00_19010) lepB 3653810..3654361 (-) 552 WP_000711857.1 signal peptidase I -
  PCT00_RS19045 (PCT00_19015) rplS 3654463..3654807 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  PCT00_RS19050 (PCT00_19020) trmD 3654954..3655688 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  PCT00_RS19055 (PCT00_19025) rimM 3655688..3656203 (-) 516 WP_000170269.1 ribosome maturation factor RimM -
  PCT00_RS19060 (PCT00_19030) - 3656324..3656551 (-) 228 WP_000737398.1 KH domain-containing protein -
  PCT00_RS19065 (PCT00_19035) rpsP 3656566..3656838 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  PCT00_RS19070 (PCT00_19040) ffh 3656939..3658288 (-) 1350 WP_000863456.1 signal recognition particle protein -
  PCT00_RS19075 (PCT00_19045) - 3658301..3658633 (-) 333 WP_000891062.1 putative DNA-binding protein -
  PCT00_RS19080 (PCT00_19050) ftsY 3658766..3659755 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  PCT00_RS19085 (PCT00_19055) smc 3659771..3663340 (-) 3570 WP_000478985.1 chromosome segregation protein SMC -
  PCT00_RS19090 (PCT00_19060) rncS 3663487..3664224 (-) 738 WP_001146873.1 ribonuclease III -
  PCT00_RS19095 (PCT00_19065) acpP 3664283..3664516 (-) 234 WP_000786062.1 acyl carrier protein -
  PCT00_RS19100 (PCT00_19070) fabG 3664586..3665326 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  PCT00_RS19105 (PCT00_19075) fabD 3665326..3666270 (-) 945 WP_000516958.1 ACP S-malonyltransferase -
  PCT00_RS19110 (PCT00_19080) plsX 3666285..3667277 (-) 993 WP_000684111.1 phosphate acyltransferase PlsX -
  PCT00_RS19115 (PCT00_19085) fapR 3667274..3667867 (-) 594 WP_000747352.1 transcription factor FapR -
  PCT00_RS19120 (PCT00_19090) recG 3667956..3670004 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  PCT00_RS19125 (PCT00_19095) - 3670294..3671970 (-) 1677 WP_000027136.1 DAK2 domain-containing protein -
  PCT00_RS19130 (PCT00_19100) - 3671993..3672355 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  PCT00_RS19135 (PCT00_19105) rpmB 3672734..3672922 (+) 189 WP_000124778.1 50S ribosomal protein L28 -
  PCT00_RS19140 (PCT00_19110) spoVM 3672995..3673075 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  PCT00_RS19145 (PCT00_19115) - 3673142..3673822 (-) 681 WP_025388434.1 thiamine diphosphokinase -
  PCT00_RS19150 (PCT00_19120) rpe 3673922..3674566 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  PCT00_RS19155 (PCT00_19125) rsgA 3674569..3675450 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  PCT00_RS19160 (PCT00_19130) prkC 3675719..3677692 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  PCT00_RS19165 (PCT00_19135) - 3677701..3678453 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  PCT00_RS19170 (PCT00_19140) rlmN 3678458..3679546 (-) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  PCT00_RS19175 (PCT00_19145) rsmB 3679551..3680885 (-) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=774083 PCT00_RS18985 WP_000421288.1 3641442..3642221(-) (codY) [Bacillus anthracis strain IAL 52]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=774083 PCT00_RS18985 WP_000421288.1 3641442..3642221(-) (codY) [Bacillus anthracis strain IAL 52]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459