Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   QMY17_RS09415 Genome accession   NZ_CP125812
Coordinates   1778583..1778966 (+) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis strain N3378-3At     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1773583..1783966
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QMY17_RS09380 corA 1774037..1774990 (+) 954 WP_014480260.1 magnesium transporter CorA -
  QMY17_RS09385 - 1774992..1775189 (+) 198 WP_014480259.1 CBS domain-containing protein -
  QMY17_RS09390 comGA 1775401..1776471 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  QMY17_RS09395 comGB 1776458..1777495 (+) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  QMY17_RS09400 comGC 1777509..1777805 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  QMY17_RS09405 comGD 1777795..1778226 (+) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  QMY17_RS09410 comGE 1778210..1778557 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  QMY17_RS09415 comGF 1778583..1778966 (+) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  QMY17_RS09420 comGG 1778967..1779341 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  QMY17_RS09425 spoIITA 1779412..1779591 (+) 180 WP_014480252.1 YqzE family protein -
  QMY17_RS09430 yqzG 1779633..1779959 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  QMY17_RS09435 tapA 1780231..1780992 (+) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  QMY17_RS09440 sipW 1780976..1781548 (+) 573 WP_003230181.1 signal peptidase I SipW -
  QMY17_RS09445 tasA 1781612..1782397 (+) 786 WP_014480250.1 biofilm matrix protein TasA -
  QMY17_RS09450 sinR 1782490..1782825 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QMY17_RS09455 sinI 1782859..1783032 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=764136 QMY17_RS09415 WP_014480254.1 1778583..1778966(+) (comGF) [Bacillus subtilis strain N3378-3At]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=764136 QMY17_RS09415 WP_014480254.1 1778583..1778966(+) (comGF) [Bacillus subtilis strain N3378-3At]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984