Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   OF864_RS23425 Genome accession   NZ_CP106987
Coordinates   4622857..4623636 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus cereus strain IBA1     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 4597560..4659321 4622857..4623636 within 0


Gene organization within MGE regions


Location: 4597560..4659321
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OF864_RS23315 (OF864_23320) - 4598130..4599029 (-) 900 WP_000868232.1 polysaccharide deacetylase family protein -
  OF864_RS23320 (OF864_23325) pnp 4599184..4601322 (-) 2139 WP_000076754.1 polyribonucleotide nucleotidyltransferase -
  OF864_RS23325 (OF864_23330) rpsO 4601483..4601752 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  OF864_RS23330 (OF864_23335) ribF 4601853..4602824 (-) 972 WP_000766704.1 bifunctional riboflavin kinase/FAD synthetase -
  OF864_RS23335 (OF864_23340) truB 4602868..4603791 (-) 924 WP_000399348.1 tRNA pseudouridine(55) synthase TruB -
  OF864_RS23340 (OF864_23345) rbfA 4603878..4604234 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  OF864_RS23345 (OF864_23350) - 4604250..4604531 (-) 282 WP_000582363.1 DUF503 family protein -
  OF864_RS23350 (OF864_23355) infB 4604528..4606588 (-) 2061 WP_000036343.1 translation initiation factor IF-2 -
  OF864_RS23355 (OF864_23360) - 4606593..4606904 (-) 312 WP_001286524.1 YlxQ family RNA-binding protein -
  OF864_RS23360 (OF864_23365) - 4606905..4607177 (-) 273 WP_000071127.1 YlxR family protein -
  OF864_RS23365 (OF864_23370) nusA 4607189..4608295 (-) 1107 WP_000102604.1 transcription termination factor NusA -
  OF864_RS23370 (OF864_23375) rimP 4608313..4608783 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  OF864_RS23375 (OF864_23380) - 4609120..4613421 (-) 4302 WP_283502509.1 PolC-type DNA polymerase III -
  OF864_RS23380 (OF864_23385) - 4613546..4615246 (-) 1701 WP_000814297.1 proline--tRNA ligase -
  OF864_RS23385 (OF864_23390) rseP 4615356..4616612 (-) 1257 WP_001090243.1 RIP metalloprotease RseP -
  OF864_RS23390 (OF864_23395) dxr 4616630..4617772 (-) 1143 WP_000790375.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  OF864_RS23395 (OF864_23400) cdsA 4617796..4618587 (-) 792 WP_000813592.1 phosphatidate cytidylyltransferase -
  OF864_RS23400 (OF864_23405) uppS 4618605..4619381 (-) 777 WP_000971296.1 isoprenyl transferase -
  OF864_RS23405 (OF864_23410) frr 4619467..4620024 (-) 558 WP_000531501.1 ribosome recycling factor -
  OF864_RS23410 (OF864_23415) pyrH 4620027..4620749 (-) 723 WP_000042668.1 UMP kinase -
  OF864_RS23415 (OF864_23420) tsf 4620816..4621703 (-) 888 WP_001018578.1 translation elongation factor Ts -
  OF864_RS23420 (OF864_23425) rpsB 4621807..4622508 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  OF864_RS23425 (OF864_23430) codY 4622857..4623636 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  OF864_RS23430 (OF864_23435) hslU 4623714..4625105 (-) 1392 WP_000550087.1 ATP-dependent protease ATPase subunit HslU -
  OF864_RS23435 (OF864_23440) hslV 4625128..4625670 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  OF864_RS23440 (OF864_23445) xerC 4625713..4626612 (-) 900 WP_044584806.1 tyrosine recombinase XerC -
  OF864_RS23445 (OF864_23450) trmFO 4626678..4627982 (-) 1305 WP_000213002.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  OF864_RS23450 (OF864_23455) topA 4628031..4630109 (-) 2079 WP_001286960.1 type I DNA topoisomerase -
  OF864_RS23455 (OF864_23460) dprA 4630254..4631123 (-) 870 WP_283502510.1 DNA-processing protein DprA -
  OF864_RS23460 (OF864_23465) sucD 4631211..4632113 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  OF864_RS23465 (OF864_23470) sucC 4632133..4633293 (-) 1161 WP_001020791.1 ADP-forming succinate--CoA ligase subunit beta -
  OF864_RS23470 (OF864_23475) - 4633488..4634261 (-) 774 WP_001194267.1 ribonuclease HII -
  OF864_RS23475 (OF864_23480) ylqF 4634318..4635208 (-) 891 WP_000236702.1 ribosome biogenesis GTPase YlqF -
  OF864_RS23480 (OF864_23485) lepB 4635229..4635780 (-) 552 WP_000711853.1 signal peptidase I -
  OF864_RS23485 (OF864_23490) rplS 4635882..4636226 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  OF864_RS23490 (OF864_23495) trmD 4636373..4637107 (-) 735 WP_000686904.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  OF864_RS23495 (OF864_23500) rimM 4637107..4637622 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  OF864_RS23500 (OF864_23505) - 4637743..4637970 (-) 228 WP_000737401.1 KH domain-containing protein -
  OF864_RS23505 (OF864_23510) rpsP 4637985..4638257 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  OF864_RS23510 (OF864_23515) ffh 4638359..4639708 (-) 1350 WP_000863460.1 signal recognition particle protein -
  OF864_RS23515 (OF864_23520) - 4639721..4640053 (-) 333 WP_000891062.1 putative DNA-binding protein -
  OF864_RS23520 (OF864_23525) ftsY 4640187..4641176 (-) 990 WP_000007655.1 signal recognition particle-docking protein FtsY -
  OF864_RS23525 (OF864_23530) smc 4641192..4644761 (-) 3570 WP_088045366.1 chromosome segregation protein SMC -
  OF864_RS23530 (OF864_23535) rncS 4644908..4645645 (-) 738 WP_001146875.1 ribonuclease III -
  OF864_RS23535 (OF864_23540) acpP 4645704..4645937 (-) 234 WP_000786062.1 acyl carrier protein -
  OF864_RS23540 (OF864_23545) fabG 4646007..4646747 (-) 741 WP_000911769.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  OF864_RS23545 (OF864_23550) fabD 4646747..4647691 (-) 945 WP_000515910.1 ACP S-malonyltransferase -
  OF864_RS23550 (OF864_23555) plsX 4647706..4648698 (-) 993 WP_000684100.1 phosphate acyltransferase PlsX -
  OF864_RS23555 (OF864_23560) fapR 4648695..4649288 (-) 594 WP_000747349.1 transcription factor FapR -
  OF864_RS23560 (OF864_23565) recG 4649377..4651425 (-) 2049 WP_001000815.1 ATP-dependent DNA helicase RecG -
  OF864_RS23565 (OF864_23570) - 4651716..4653392 (-) 1677 WP_000027129.1 DAK2 domain-containing protein -
  OF864_RS23570 (OF864_23575) - 4653415..4653777 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  OF864_RS23575 (OF864_23580) rpmB 4654154..4654342 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  OF864_RS23580 (OF864_23585) spoVM 4654416..4654496 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  OF864_RS23585 (OF864_23590) - 4654563..4655243 (-) 681 WP_000752663.1 thiamine diphosphokinase -
  OF864_RS23590 (OF864_23595) rpe 4655313..4655957 (-) 645 WP_000589974.1 ribulose-phosphate 3-epimerase -
  OF864_RS23595 (OF864_23600) rsgA 4655960..4656841 (-) 882 WP_001113932.1 ribosome small subunit-dependent GTPase A -
  OF864_RS23600 (OF864_23605) pknB 4657088..4659061 (-) 1974 WP_000904748.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=736922 OF864_RS23425 WP_000421290.1 4622857..4623636(-) (codY) [Bacillus cereus strain IBA1]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=736922 OF864_RS23425 WP_000421290.1 4622857..4623636(-) (codY) [Bacillus cereus strain IBA1]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCACGTAGTAAAGCTGTTGTTCAAATGGCAATCAGCTCATTATCTTACAGTGAGTTAGAAGCGAT
TGAGCACATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GTTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAGGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459