Detailed information
Overview
| Name | pilH | Type | Machinery gene |
| Locus tag | LLE27_RS02340 | Genome accession | NZ_CP106782 |
| Coordinates | 451230..451895 (+) | Length | 221 a.a. |
| NCBI ID | WP_003699624.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 10795 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 444395..506161 | 451230..451895 | within | 0 |
Gene organization within MGE regions
Location: 444395..506161
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE27_RS02305 (LLE27_02305) | - | 444395..445471 (-) | 1077 | WP_003692814.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| LLE27_RS02310 (LLE27_02310) | cysW | 445468..446328 (-) | 861 | WP_003699617.1 | sulfate ABC transporter permease subunit CysW | - |
| LLE27_RS02315 (LLE27_02315) | cysT | 446517..447344 (-) | 828 | WP_003699619.1 | sulfate ABC transporter permease subunit CysT | - |
| LLE27_RS02320 (LLE27_02320) | - | 447525..447857 (+) | 333 | WP_003687908.1 | hypothetical protein | - |
| LLE27_RS02325 (LLE27_02325) | - | 448184..448693 (+) | 510 | WP_003687909.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| LLE27_RS02330 (LLE27_02330) | - | 448925..449506 (-) | 582 | WP_003690895.1 | superoxide dismutase | - |
| LLE27_RS02335 (LLE27_02335) | dnaB | 449670..451076 (+) | 1407 | WP_003699622.1 | replicative DNA helicase | - |
| LLE27_RS02340 (LLE27_02340) | pilH | 451230..451895 (+) | 666 | WP_003699624.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| LLE27_RS02345 (LLE27_02345) | pilV | 451927..452538 (+) | 612 | WP_003699626.1 | type IV pilus modification protein PilV | Machinery gene |
| LLE27_RS02350 (LLE27_02350) | pilJ | 452535..453485 (+) | 951 | WP_003699627.1 | PilW family protein | Machinery gene |
| LLE27_RS02355 (LLE27_02355) | pilK | 453464..454075 (+) | 612 | WP_033911077.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| LLE27_RS02360 (LLE27_02360) | pilL | 454077..454550 (+) | 474 | WP_172760650.1 | PilX family type IV pilin | Machinery gene |
| LLE27_RS02365 (LLE27_02365) | - | 454620..454928 (-) | 309 | WP_025456177.1 | AzlD family protein | - |
| LLE27_RS02370 (LLE27_02370) | - | 454925..455635 (-) | 711 | Protein_466 | AzlC family ABC transporter permease | - |
| LLE27_RS02375 (LLE27_02375) | dut | 455801..456253 (+) | 453 | WP_003699637.1 | dUTP diphosphatase | - |
| LLE27_RS02380 (LLE27_02380) | dapC | 456329..457516 (+) | 1188 | WP_003699639.1 | succinyldiaminopimelate transaminase | - |
| LLE27_RS02385 (LLE27_02385) | yaaA | 457672..458451 (+) | 780 | WP_003699641.1 | peroxide stress protein YaaA | - |
| LLE27_RS02400 (LLE27_02400) | - | 458981..460174 (+) | 1194 | WP_017146746.1 | phage integrase central domain-containing protein | - |
| LLE27_RS02405 (LLE27_02405) | - | 460530..460799 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| LLE27_RS02410 (LLE27_02410) | - | 460994..461677 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| LLE27_RS11725 | - | 461958..462224 (-) | 267 | Protein_473 | hypothetical protein | - |
| LLE27_RS02420 (LLE27_02420) | - | 462335..462550 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| LLE27_RS02425 (LLE27_02425) | - | 462602..463093 (-) | 492 | WP_033911206.1 | siphovirus Gp157 family protein | - |
| LLE27_RS02430 (LLE27_02430) | - | 463090..463272 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| LLE27_RS02435 (LLE27_02435) | - | 463412..464098 (-) | 687 | WP_010357532.1 | phage replication initiation protein, NGO0469 family | - |
| LLE27_RS02440 (LLE27_02440) | - | 464167..464328 (-) | 162 | WP_003693867.1 | hypothetical protein | - |
| LLE27_RS02445 (LLE27_02445) | - | 464325..464603 (-) | 279 | WP_229930232.1 | NGO1622 family putative holin | - |
| LLE27_RS02450 (LLE27_02450) | - | 464756..465088 (-) | 333 | WP_003695500.1 | hypothetical protein | - |
| LLE27_RS02455 (LLE27_02455) | - | 465230..465505 (-) | 276 | WP_082285043.1 | hypothetical protein | - |
| LLE27_RS02460 (LLE27_02460) | - | 465502..465978 (-) | 477 | WP_002255718.1 | DUF6948 domain-containing protein | - |
| LLE27_RS02465 (LLE27_02465) | - | 466011..466211 (-) | 201 | WP_003692842.1 | hypothetical protein | - |
| LLE27_RS02470 (LLE27_02470) | - | 466695..466913 (+) | 219 | WP_003691731.1 | hypothetical protein | - |
| LLE27_RS02475 (LLE27_02475) | - | 466930..467289 (-) | 360 | WP_003691733.1 | hypothetical protein | - |
| LLE27_RS02480 (LLE27_02480) | - | 467290..467829 (-) | 540 | WP_003695998.1 | Panacea domain-containing protein | - |
| LLE27_RS02485 (LLE27_02485) | - | 467989..468705 (-) | 717 | WP_003695999.1 | helix-turn-helix transcriptional regulator | - |
| LLE27_RS02490 (LLE27_02490) | - | 469086..469313 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| LLE27_RS02495 (LLE27_02495) | - | 469431..470495 (+) | 1065 | WP_003689134.1 | hypothetical protein | - |
| LLE27_RS02500 (LLE27_02500) | - | 470492..471853 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| LLE27_RS02505 (LLE27_02505) | - | 471870..472100 (+) | 231 | WP_012503490.1 | hypothetical protein | - |
| LLE27_RS02510 (LLE27_02510) | - | 472192..472686 (+) | 495 | WP_003691434.1 | DUF3310 domain-containing protein | - |
| LLE27_RS02515 (LLE27_02515) | - | 472863..473012 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| LLE27_RS02520 (LLE27_02520) | - | 473040..473321 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| LLE27_RS02525 (LLE27_02525) | - | 473312..473692 (+) | 381 | WP_033911195.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LLE27_RS02530 (LLE27_02530) | - | 473959..474366 (+) | 408 | WP_003691430.1 | hypothetical protein | - |
| LLE27_RS02535 (LLE27_02535) | - | 474457..475617 (+) | 1161 | WP_003691428.1 | type I restriction endonuclease | - |
| LLE27_RS02540 (LLE27_02540) | - | 475899..476768 (+) | 870 | WP_003700071.1 | BRO family protein | - |
| LLE27_RS02545 (LLE27_02545) | - | 477061..477510 (+) | 450 | WP_003689093.1 | hypothetical protein | - |
| LLE27_RS02550 (LLE27_02550) | terL | 477572..478993 (+) | 1422 | WP_003697216.1 | phage terminase large subunit | - |
| LLE27_RS02555 (LLE27_02555) | - | 478990..481137 (+) | 2148 | WP_003691423.1 | phage portal protein | - |
| LLE27_RS02560 (LLE27_02560) | - | 481205..482362 (+) | 1158 | WP_003700068.1 | hypothetical protein | - |
| LLE27_RS02565 (LLE27_02565) | - | 482403..483902 (+) | 1500 | WP_003691419.1 | hypothetical protein | - |
| LLE27_RS02570 (LLE27_02570) | - | 483909..484271 (+) | 363 | WP_003689082.1 | hypothetical protein | - |
| LLE27_RS02575 (LLE27_02575) | - | 484274..484804 (+) | 531 | WP_003689080.1 | head-tail connector protein | - |
| LLE27_RS02580 (LLE27_02580) | - | 484804..485286 (+) | 483 | WP_003706029.1 | HK97 gp10 family phage protein | - |
| LLE27_RS02585 (LLE27_02585) | - | 485283..485711 (+) | 429 | WP_003697213.1 | hypothetical protein | - |
| LLE27_RS02590 (LLE27_02590) | - | 485737..486510 (+) | 774 | WP_003691416.1 | hypothetical protein | - |
| LLE27_RS02595 (LLE27_02595) | - | 486572..486901 (+) | 330 | WP_003689072.1 | hypothetical protein | - |
| LLE27_RS02600 (LLE27_02600) | - | 486913..487179 (+) | 267 | WP_003692873.1 | hypothetical protein | - |
| LLE27_RS02605 (LLE27_02605) | - | 487179..487778 (+) | 600 | WP_003692874.1 | DUF2460 domain-containing protein | - |
| LLE27_RS02610 (LLE27_02610) | - | 487775..488629 (+) | 855 | WP_003698614.1 | DUF2163 domain-containing protein | - |
| LLE27_RS02615 (LLE27_02615) | - | 488631..489062 (+) | 432 | WP_003689064.1 | NlpC/P60 family protein | - |
| LLE27_RS02620 (LLE27_02620) | - | 489090..489368 (-) | 279 | WP_229930233.1 | helix-turn-helix domain-containing protein | - |
| LLE27_RS02625 (LLE27_02625) | - | 489608..493754 (+) | 4147 | Protein_515 | phage tail protein | - |
| LLE27_RS02635 (LLE27_02635) | - | 493866..494171 (+) | 306 | WP_003689058.1 | hypothetical protein | - |
| LLE27_RS02640 (LLE27_02640) | - | 494242..494712 (+) | 471 | WP_025455988.1 | hypothetical protein | - |
| LLE27_RS02645 (LLE27_02645) | - | 494713..495045 (+) | 333 | WP_003691408.1 | hypothetical protein | - |
| LLE27_RS02650 (LLE27_02650) | - | 495413..495760 (-) | 348 | WP_003689051.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| LLE27_RS02655 (LLE27_02655) | - | 495760..495996 (-) | 237 | WP_003689049.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| LLE27_RS02660 (LLE27_02660) | - | 496203..496742 (+) | 540 | WP_047951643.1 | TIGR02594 family protein | - |
| LLE27_RS02665 (LLE27_02665) | - | 496742..496900 (+) | 159 | WP_003691816.1 | hypothetical protein | - |
| LLE27_RS02670 (LLE27_02670) | - | 496884..497225 (+) | 342 | WP_003696082.1 | hypothetical protein | - |
| LLE27_RS02675 (LLE27_02675) | - | 497209..497382 (+) | 174 | WP_003705498.1 | hypothetical protein | - |
| LLE27_RS02680 (LLE27_02680) | - | 497694..497843 (+) | 150 | WP_003691402.1 | hypothetical protein | - |
| LLE27_RS02685 (LLE27_02685) | - | 497873..500917 (+) | 3045 | WP_229930235.1 | tape measure protein | - |
| LLE27_RS02690 (LLE27_02690) | - | 500977..501456 (-) | 480 | WP_002241413.1 | DUF4760 domain-containing protein | - |
| LLE27_RS02695 (LLE27_02695) | - | 501798..502787 (-) | 990 | WP_003689040.1 | site-specific integrase | - |
| LLE27_RS02700 (LLE27_02700) | - | 503047..503235 (-) | 189 | WP_003689039.1 | hypothetical protein | - |
| LLE27_RS02705 (LLE27_02705) | purM | 503476..504510 (+) | 1035 | WP_003692893.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| LLE27_RS02710 (LLE27_02710) | - | 505508..506161 (+) | 654 | WP_134994130.1 | IS1595 family transposase | - |
Sequence
Protein
Download Length: 221 a.a. Molecular weight: 24648.03 Da Isoelectric Point: 8.8981
>NTDB_id=735027 LLE27_RS02340 WP_003699624.1 451230..451895(+) (pilH) [Neisseria gonorrhoeae strain 10795]
MCTRKQQGFTLTELLIVMAIAAIMATIALPNMSGWIASRRIASHAEQIANLLRFSRGEAVRLNLPVYICPVQVKKDGAPN
NRCDFSKKGWGMLAFGDKNGNKAYDGDVADVFLRSVVLNDDINDKRIDYAFNHIAFGSSQPTADRVVWTFNQNGTFGYTT
DQHLTERSSFFYSDGYIQIVLTDARAVSDADKKFRSAVVLINSSGRVEVCPRNDRRAVCQH
MCTRKQQGFTLTELLIVMAIAAIMATIALPNMSGWIASRRIASHAEQIANLLRFSRGEAVRLNLPVYICPVQVKKDGAPN
NRCDFSKKGWGMLAFGDKNGNKAYDGDVADVFLRSVVLNDDINDKRIDYAFNHIAFGSSQPTADRVVWTFNQNGTFGYTT
DQHLTERSSFFYSDGYIQIVLTDARAVSDADKKFRSAVVLINSSGRVEVCPRNDRRAVCQH
Nucleotide
Download Length: 666 bp
>NTDB_id=735027 LLE27_RS02340 WP_003699624.1 451230..451895(+) (pilH) [Neisseria gonorrhoeae strain 10795]
ATGTGTACACGAAAACAACAAGGTTTCACGCTAACAGAGCTGCTCATCGTGATGGCCATTGCAGCCATTATGGCGACGAT
AGCCCTCCCCAATATGAGTGGGTGGATTGCATCACGCCGCATTGCCAGTCACGCGGAGCAGATTGCCAACCTTTTGCGTT
TCTCCAGGGGCGAAGCCGTCCGGCTCAATCTCCCTGTCTATATCTGTCCTGTTCAAGTTAAAAAAGACGGTGCGCCCAAC
AATAGATGTGACTTCAGCAAGAAGGGGTGGGGAATGTTGGCTTTCGGCGACAAAAACGGCAATAAGGCATATGACGGCGA
TGTGGCGGATGTTTTCCTCCGCAGCGTGGTATTGAATGATGATATCAATGATAAGCGGATTGATTATGCCTTCAACCATA
TCGCTTTCGGTTCGTCTCAGCCGACCGCCGACCGTGTAGTTTGGACGTTCAATCAAAACGGGACGTTCGGTTATACGACA
GACCAGCATCTTACAGAGCGATCCAGCTTTTTTTATTCCGACGGTTATATCCAAATCGTGCTGACAGATGCGAGAGCAGT
TTCAGATGCCGATAAGAAATTCCGTTCGGCGGTGGTTTTGATTAACAGCAGCGGCAGGGTTGAAGTTTGCCCTAGAAACG
ATAGGCGTGCCGTATGCCAACATTAA
ATGTGTACACGAAAACAACAAGGTTTCACGCTAACAGAGCTGCTCATCGTGATGGCCATTGCAGCCATTATGGCGACGAT
AGCCCTCCCCAATATGAGTGGGTGGATTGCATCACGCCGCATTGCCAGTCACGCGGAGCAGATTGCCAACCTTTTGCGTT
TCTCCAGGGGCGAAGCCGTCCGGCTCAATCTCCCTGTCTATATCTGTCCTGTTCAAGTTAAAAAAGACGGTGCGCCCAAC
AATAGATGTGACTTCAGCAAGAAGGGGTGGGGAATGTTGGCTTTCGGCGACAAAAACGGCAATAAGGCATATGACGGCGA
TGTGGCGGATGTTTTCCTCCGCAGCGTGGTATTGAATGATGATATCAATGATAAGCGGATTGATTATGCCTTCAACCATA
TCGCTTTCGGTTCGTCTCAGCCGACCGCCGACCGTGTAGTTTGGACGTTCAATCAAAACGGGACGTTCGGTTATACGACA
GACCAGCATCTTACAGAGCGATCCAGCTTTTTTTATTCCGACGGTTATATCCAAATCGTGCTGACAGATGCGAGAGCAGT
TTCAGATGCCGATAAGAAATTCCGTTCGGCGGTGGTTTTGATTAACAGCAGCGGCAGGGTTGAAGTTTGCCCTAGAAACG
ATAGGCGTGCCGTATGCCAACATTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilH | Neisseria gonorrhoeae MS11 |
90.045 |
100 |
0.9 |