Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilH   Type   Machinery gene
Locus tag   LLE29_RS02360 Genome accession   NZ_CP106780
Coordinates   451236..451901 (+) Length   221 a.a.
NCBI ID   WP_003699624.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 10794     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 444401..506547 451236..451901 within 0


Gene organization within MGE regions


Location: 444401..506547
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLE29_RS02325 (LLE29_02325) - 444401..445477 (-) 1077 WP_003692814.1 sulfate/molybdate ABC transporter ATP-binding protein -
  LLE29_RS02330 (LLE29_02330) cysW 445474..446334 (-) 861 WP_003699617.1 sulfate ABC transporter permease subunit CysW -
  LLE29_RS02335 (LLE29_02335) cysT 446523..447350 (-) 828 WP_003699619.1 sulfate ABC transporter permease subunit CysT -
  LLE29_RS02340 (LLE29_02340) - 447531..447863 (+) 333 WP_003687908.1 hypothetical protein -
  LLE29_RS02345 (LLE29_02345) - 448190..448699 (+) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  LLE29_RS02350 (LLE29_02350) - 448931..449512 (-) 582 WP_003690895.1 superoxide dismutase -
  LLE29_RS02355 (LLE29_02355) dnaB 449676..451082 (+) 1407 WP_003699622.1 replicative DNA helicase -
  LLE29_RS02360 (LLE29_02360) pilH 451236..451901 (+) 666 WP_003699624.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  LLE29_RS02365 (LLE29_02365) pilV 451933..452544 (+) 612 WP_003699626.1 type IV pilus modification protein PilV Machinery gene
  LLE29_RS02370 (LLE29_02370) pilJ 452541..453491 (+) 951 WP_003699627.1 PilW family protein Machinery gene
  LLE29_RS02375 (LLE29_02375) pilK 453470..454081 (+) 612 WP_033911077.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  LLE29_RS02380 (LLE29_02380) pilL 454083..454556 (+) 474 WP_172760650.1 PilX family type IV pilin Machinery gene
  LLE29_RS02385 (LLE29_02385) - 454626..454934 (-) 309 WP_025456177.1 AzlD family protein -
  LLE29_RS02390 (LLE29_02390) - 454931..455641 (-) 711 Protein_468 AzlC family ABC transporter permease -
  LLE29_RS02395 (LLE29_02395) dut 455807..456259 (+) 453 WP_003699637.1 dUTP diphosphatase -
  LLE29_RS02400 (LLE29_02400) dapC 456335..457522 (+) 1188 WP_003699639.1 succinyldiaminopimelate transaminase -
  LLE29_RS02405 (LLE29_02405) yaaA 457678..458457 (+) 780 WP_003699641.1 peroxide stress protein YaaA -
  LLE29_RS02420 (LLE29_02420) - 458987..460180 (+) 1194 WP_017146746.1 phage integrase central domain-containing protein -
  LLE29_RS02425 (LLE29_02425) - 460536..460805 (-) 270 WP_003687928.1 hypothetical protein -
  LLE29_RS02430 (LLE29_02430) - 461000..461683 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  LLE29_RS11755 - 461964..462230 (-) 267 Protein_475 hypothetical protein -
  LLE29_RS02440 (LLE29_02440) - 462341..462556 (-) 216 WP_003691538.1 hypothetical protein -
  LLE29_RS02445 (LLE29_02445) - 462608..463099 (-) 492 WP_033911206.1 siphovirus Gp157 family protein -
  LLE29_RS02450 (LLE29_02450) - 463096..463278 (-) 183 WP_003691535.1 hypothetical protein -
  LLE29_RS02455 (LLE29_02455) - 463418..464104 (-) 687 WP_042758540.1 phage replication initiation protein, NGO0469 family -
  LLE29_RS02460 (LLE29_02460) - 464173..464334 (-) 162 WP_003693867.1 hypothetical protein -
  LLE29_RS02465 (LLE29_02465) - 464331..464609 (-) 279 WP_041421244.1 NGO1622 family putative holin -
  LLE29_RS02470 (LLE29_02470) - 464762..465094 (-) 333 WP_003695500.1 hypothetical protein -
  LLE29_RS02475 (LLE29_02475) - 465236..465541 (-) 306 WP_260240049.1 hypothetical protein -
  LLE29_RS02480 (LLE29_02480) - 465538..466014 (-) 477 WP_002255718.1 DUF6948 domain-containing protein -
  LLE29_RS02485 (LLE29_02485) - 466047..466247 (-) 201 WP_003692842.1 hypothetical protein -
  LLE29_RS02490 (LLE29_02490) - 466445..466858 (-) 414 WP_003687963.1 hypothetical protein -
  LLE29_RS02495 (LLE29_02495) - 466855..467316 (-) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  LLE29_RS02500 (LLE29_02500) - 467333..467770 (-) 438 WP_003687967.1 hypothetical protein -
  LLE29_RS02505 (LLE29_02505) - 467883..468599 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  LLE29_RS02510 (LLE29_02510) - 468674..468904 (+) 231 WP_020997318.1 Cro/CI family transcriptional regulator -
  LLE29_RS02515 (LLE29_02515) - 468984..469139 (+) 156 WP_003698902.1 hypothetical protein -
  LLE29_RS02520 (LLE29_02520) - 469116..469304 (-) 189 WP_003691445.1 hypothetical protein -
  LLE29_RS02525 (LLE29_02525) - 469477..469704 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  LLE29_RS02530 (LLE29_02530) - 469822..470886 (+) 1065 WP_003689134.1 hypothetical protein -
  LLE29_RS02535 (LLE29_02535) - 470883..472244 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  LLE29_RS02540 (LLE29_02540) - 472261..472491 (+) 231 WP_012503490.1 hypothetical protein -
  LLE29_RS02545 (LLE29_02545) - 472583..473077 (+) 495 WP_003691434.1 DUF3310 domain-containing protein -
  LLE29_RS02550 (LLE29_02550) - 473254..473403 (+) 150 WP_003689110.1 hypothetical protein -
  LLE29_RS02555 (LLE29_02555) - 473431..473712 (+) 282 WP_003689109.1 hypothetical protein -
  LLE29_RS02560 (LLE29_02560) - 473703..474083 (+) 381 WP_033911195.1 RusA family crossover junction endodeoxyribonuclease -
  LLE29_RS02565 (LLE29_02565) - 474100..474228 (-) 129 WP_012503747.1 hypothetical protein -
  LLE29_RS02570 (LLE29_02570) - 474350..474757 (+) 408 WP_003691430.1 hypothetical protein -
  LLE29_RS02575 (LLE29_02575) - 474848..476008 (+) 1161 WP_003691428.1 type I restriction endonuclease -
  LLE29_RS02580 (LLE29_02580) - 476290..477159 (+) 870 WP_003700071.1 BRO family protein -
  LLE29_RS02585 (LLE29_02585) - 477452..477901 (+) 450 WP_003689093.1 hypothetical protein -
  LLE29_RS02590 (LLE29_02590) terL 477963..479384 (+) 1422 WP_003697216.1 phage terminase large subunit -
  LLE29_RS02595 (LLE29_02595) - 479381..481528 (+) 2148 WP_003691423.1 phage portal protein -
  LLE29_RS02600 (LLE29_02600) - 481596..482753 (+) 1158 WP_003700068.1 hypothetical protein -
  LLE29_RS02605 (LLE29_02605) - 482794..484293 (+) 1500 WP_003691419.1 hypothetical protein -
  LLE29_RS02610 (LLE29_02610) - 484300..484662 (+) 363 WP_003689082.1 hypothetical protein -
  LLE29_RS02615 (LLE29_02615) - 484665..485195 (+) 531 WP_003689080.1 head-tail connector protein -
  LLE29_RS02620 (LLE29_02620) - 485195..485677 (+) 483 WP_003706029.1 HK97 gp10 family phage protein -
  LLE29_RS02625 (LLE29_02625) - 485674..486102 (+) 429 WP_003697213.1 hypothetical protein -
  LLE29_RS02630 (LLE29_02630) - 486128..486901 (+) 774 WP_003691416.1 hypothetical protein -
  LLE29_RS02635 (LLE29_02635) - 486963..487292 (+) 330 WP_003689072.1 hypothetical protein -
  LLE29_RS02640 (LLE29_02640) - 487304..487570 (+) 267 WP_003692873.1 hypothetical protein -
  LLE29_RS02645 (LLE29_02645) - 487570..488169 (+) 600 WP_003692874.1 DUF2460 domain-containing protein -
  LLE29_RS02650 (LLE29_02650) - 488166..489020 (+) 855 WP_003698614.1 DUF2163 domain-containing protein -
  LLE29_RS02655 (LLE29_02655) - 489022..489453 (+) 432 WP_003689064.1 NlpC/P60 family protein -
  LLE29_RS02660 (LLE29_02660) - 489481..489759 (-) 279 WP_229930233.1 helix-turn-helix domain-containing protein -
  LLE29_RS02665 (LLE29_02665) - 489999..494144 (+) 4146 WP_025456199.1 phage tail protein -
  LLE29_RS02670 (LLE29_02670) - 494256..494561 (+) 306 WP_003689058.1 hypothetical protein -
  LLE29_RS02675 (LLE29_02675) - 494632..495102 (+) 471 WP_025455988.1 hypothetical protein -
  LLE29_RS02680 (LLE29_02680) - 495103..495435 (+) 333 WP_003691408.1 hypothetical protein -
  LLE29_RS02685 (LLE29_02685) - 495803..496150 (-) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  LLE29_RS02690 (LLE29_02690) - 496150..496386 (-) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  LLE29_RS02695 (LLE29_02695) - 496593..497132 (+) 540 WP_047951643.1 TIGR02594 family protein -
  LLE29_RS02700 (LLE29_02700) - 497132..497290 (+) 159 WP_003691816.1 hypothetical protein -
  LLE29_RS02705 (LLE29_02705) - 497274..497615 (+) 342 WP_003700102.1 hypothetical protein -
  LLE29_RS02710 (LLE29_02710) - 497599..497772 (+) 174 WP_012504144.1 hypothetical protein -
  LLE29_RS02715 (LLE29_02715) - 498084..498233 (+) 150 WP_003691402.1 hypothetical protein -
  LLE29_RS02720 (LLE29_02720) - 498263..501307 (+) 3045 WP_229930235.1 tape measure protein -
  LLE29_RS02725 (LLE29_02725) - 501367..501846 (-) 480 WP_002241413.1 DUF4760 domain-containing protein -
  LLE29_RS02730 (LLE29_02730) - 502188..503177 (-) 990 WP_003689040.1 site-specific integrase -
  LLE29_RS02735 (LLE29_02735) - 503437..503625 (-) 189 WP_003689039.1 hypothetical protein -
  LLE29_RS02740 (LLE29_02740) purM 503866..504900 (+) 1035 WP_003692893.1 phosphoribosylformylglycinamidine cyclo-ligase -
  LLE29_RS02745 (LLE29_02745) - 505899..506547 (+) 649 Protein_537 IS1595 family transposase -

Sequence

Protein


Download         Length: 221 a.a.        Molecular weight: 24648.03 Da        Isoelectric Point: 8.8981

>NTDB_id=734977 LLE29_RS02360 WP_003699624.1 451236..451901(+) (pilH) [Neisseria gonorrhoeae strain 10794]
MCTRKQQGFTLTELLIVMAIAAIMATIALPNMSGWIASRRIASHAEQIANLLRFSRGEAVRLNLPVYICPVQVKKDGAPN
NRCDFSKKGWGMLAFGDKNGNKAYDGDVADVFLRSVVLNDDINDKRIDYAFNHIAFGSSQPTADRVVWTFNQNGTFGYTT
DQHLTERSSFFYSDGYIQIVLTDARAVSDADKKFRSAVVLINSSGRVEVCPRNDRRAVCQH

Nucleotide


Download         Length: 666 bp        

>NTDB_id=734977 LLE29_RS02360 WP_003699624.1 451236..451901(+) (pilH) [Neisseria gonorrhoeae strain 10794]
ATGTGTACACGAAAACAACAAGGTTTCACGCTAACAGAGCTGCTCATCGTGATGGCCATTGCAGCCATTATGGCGACGAT
AGCCCTCCCCAATATGAGTGGGTGGATTGCATCACGCCGCATTGCCAGTCACGCGGAGCAGATTGCCAACCTTTTGCGTT
TCTCCAGGGGCGAAGCCGTCCGGCTCAATCTCCCTGTCTATATCTGTCCTGTTCAAGTTAAAAAAGACGGTGCGCCCAAC
AATAGATGTGACTTCAGCAAGAAGGGGTGGGGAATGTTGGCTTTCGGCGACAAAAACGGCAATAAGGCATATGACGGCGA
TGTGGCGGATGTTTTCCTCCGCAGCGTGGTATTGAATGATGATATCAATGATAAGCGGATTGATTATGCCTTCAACCATA
TCGCTTTCGGTTCGTCTCAGCCGACCGCCGACCGTGTAGTTTGGACGTTCAATCAAAACGGGACGTTCGGTTATACGACA
GACCAGCATCTTACAGAGCGATCCAGCTTTTTTTATTCCGACGGTTATATCCAAATCGTGCTGACAGATGCGAGAGCAGT
TTCAGATGCCGATAAGAAATTCCGTTCGGCGGTGGTTTTGATTAACAGCAGCGGCAGGGTTGAAGTTTGCCCTAGAAACG
ATAGGCGTGCCGTATGCCAACATTAA

Domains

Predicted by InterproScan.

Type II transport protein GspH (GspH)

(44-205)

Prokaryotic N-terminal methylation motif (N_methyl)

(4-29)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilH Neisseria gonorrhoeae MS11

90.045

100

0.9