Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   P1J77_RS07240 Genome accession   NZ_CP119597
Coordinates   1494285..1494569 (-) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain 1039     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1489285..1499569
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P1J77_RS07210 (P1J77_07210) proC 1489894..1490664 (+) 771 WP_136274084.1 pyrroline-5-carboxylate reductase -
  P1J77_RS07215 (P1J77_07215) - 1490747..1491055 (-) 309 WP_010921804.1 hypothetical protein -
  P1J77_RS07220 (P1J77_07220) - 1491242..1492438 (-) 1197 WP_023612537.1 acetate kinase -
  P1J77_RS07225 (P1J77_07225) comGH 1492497..1493450 (-) 954 WP_136274080.1 class I SAM-dependent methyltransferase Machinery gene
  P1J77_RS07230 (P1J77_07230) comGG 1493548..1493874 (-) 327 WP_136274078.1 competence type IV pilus minor pilin ComGG -
  P1J77_RS07235 (P1J77_07235) comGF 1493858..1494292 (-) 435 WP_023612536.1 competence type IV pilus minor pilin ComGF Machinery gene
  P1J77_RS07240 (P1J77_07240) comGE 1494285..1494569 (-) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  P1J77_RS07245 (P1J77_07245) comGD 1494526..1494954 (-) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  P1J77_RS07250 (P1J77_07250) comGC 1494929..1495255 (-) 327 WP_032465607.1 competence type IV pilus major pilin ComGC Machinery gene
  P1J77_RS07255 (P1J77_07255) comGB 1495257..1496291 (-) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  P1J77_RS07260 (P1J77_07260) comGA 1496227..1497165 (-) 939 WP_002986557.1 competence type IV pilus ATPase ComGA Machinery gene
  P1J77_RS07265 (P1J77_07265) - 1497258..1497623 (-) 366 WP_002986560.1 DUF1033 family protein -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=727010 P1J77_RS07240 WP_002987779.1 1494285..1494569(-) (comGE) [Streptococcus pyogenes strain 1039]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=727010 P1J77_RS07240 WP_002987779.1 1494285..1494569(-) (comGE) [Streptococcus pyogenes strain 1039]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383