Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   PVK49_RS00670 Genome accession   NZ_CP118306
Coordinates   104714..104998 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain 20154608     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99714..109998
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PVK49_RS00645 (PVK49_00650) - 101659..102024 (+) 366 WP_002986560.1 DUF1033 family protein -
  PVK49_RS00650 (PVK49_00655) comGA 102117..103055 (+) 939 WP_047235612.1 competence type IV pilus ATPase ComGA Machinery gene
  PVK49_RS00655 (PVK49_00660) comGB 102991..104026 (+) 1036 Protein_80 competence type IV pilus assembly protein ComGB -
  PVK49_RS00660 (PVK49_00665) comGC 104028..104354 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  PVK49_RS00665 (PVK49_00670) comGD 104329..104757 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  PVK49_RS00670 (PVK49_00675) comGE 104714..104998 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  PVK49_RS00675 (PVK49_00680) comGF 104991..105425 (+) 435 WP_002986542.1 competence type IV pilus minor pilin ComGF Machinery gene
  PVK49_RS00680 (PVK49_00685) comGG 105409..105735 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  PVK49_RS00685 (PVK49_00690) comGH 105833..106786 (+) 954 WP_002987790.1 class I SAM-dependent methyltransferase Machinery gene
  PVK49_RS00690 (PVK49_00695) - 106845..108041 (+) 1197 WP_011284424.1 acetate kinase -
  PVK49_RS00695 (PVK49_00700) - 108228..108536 (+) 309 WP_011284425.1 hypothetical protein -
  PVK49_RS00700 (PVK49_00705) proC 108619..109389 (-) 771 WP_032464773.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=721603 PVK49_RS00670 WP_002987779.1 104714..104998(+) (comGE) [Streptococcus pyogenes strain 20154608]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=721603 PVK49_RS00670 WP_002987779.1 104714..104998(+) (comGE) [Streptococcus pyogenes strain 20154608]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTGAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CTTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAT
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383